Orcinus orca (killer whale): 101289477 Help Entry 101289477         CDS       T05247                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism oor  Orcinus orca (killer whale) Pathway oor04024   cAMP signaling pathway oor04062   Chemokine signaling pathway oor04064   NF-kappa B signaling pathway oor04210   Apoptosis oor04380   Osteoclast differentiation oor04620   Toll-like receptor signaling pathway oor04621   NOD-like receptor signaling pathway oor04622   RIG-I-like receptor signaling pathway oor04623   Cytosolic DNA-sensing pathway oor04625   C-type lectin receptor signaling pathway oor04657   IL-17 signaling pathway oor04658   Th1 and Th2 cell differentiation oor04659   Th17 cell differentiation oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04668   TNF signaling pathway oor04722   Neurotrophin signaling pathway oor04920   Adipocytokine signaling pathway oor04926   Relaxin signaling pathway oor04931   Insulin resistance oor04936   Alcoholic liver disease oor05132   Salmonella infection oor05134   Legionellosis oor05135   Yersinia infection oor05140   Leishmaniasis oor05142   Chagas disease oor05145   Toxoplasmosis oor05160   Hepatitis C oor05161   Hepatitis B oor05162   Measles oor05163   Human cytomegalovirus infection oor05164   Influenza A oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05168   Herpes simplex virus 1 infection oor05169   Epstein-Barr virus infection oor05170   Human immunodeficiency virus 1 infection oor05171   Coronavirus disease - COVID-19 oor05200   Pathways in cancer oor05203   Viral carcinogenesis oor05208   Chemical carcinogenesis - reactive oxygen species oor05215   Prostate cancer oor05220   Chronic myeloid leukemia oor05222   Small cell lung cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101289477 (NFKBIA)    04668 TNF signaling pathway     101289477 (NFKBIA)    04024 cAMP signaling pathway     101289477 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101289477 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101289477 (NFKBIA)    04621 NOD-like receptor signaling pathway     101289477 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     101289477 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     101289477 (NFKBIA)    04625 C-type lectin receptor signaling pathway     101289477 (NFKBIA)    04660 T cell receptor signaling pathway     101289477 (NFKBIA)    04658 Th1 and Th2 cell differentiation     101289477 (NFKBIA)    04659 Th17 cell differentiation     101289477 (NFKBIA)    04657 IL-17 signaling pathway     101289477 (NFKBIA)    04662 B cell receptor signaling pathway     101289477 (NFKBIA)    04062 Chemokine signaling pathway     101289477 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101289477 (NFKBIA)    04926 Relaxin signaling pathway     101289477 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101289477 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     101289477 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101289477 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     101289477 (NFKBIA)    05203 Viral carcinogenesis     101289477 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101289477 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     101289477 (NFKBIA)    05215 Prostate cancer     101289477 (NFKBIA)    05222 Small cell lung cancer     101289477 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101289477 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     101289477 (NFKBIA)    05161 Hepatitis B     101289477 (NFKBIA)    05160 Hepatitis C     101289477 (NFKBIA)    05171 Coronavirus disease - COVID-19     101289477 (NFKBIA)    05164 Influenza A     101289477 (NFKBIA)    05162 Measles     101289477 (NFKBIA)    05168 Herpes simplex virus 1 infection     101289477 (NFKBIA)    05163 Human cytomegalovirus infection     101289477 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     101289477 (NFKBIA)    05169 Epstein-Barr virus infection     101289477 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101289477 (NFKBIA)    05135 Yersinia infection     101289477 (NFKBIA)    05134 Legionellosis     101289477 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101289477 (NFKBIA)    05140 Leishmaniasis     101289477 (NFKBIA)    05142 Chagas disease     101289477 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101289477 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101289477 (NFKBIA)    04931 Insulin resistance     101289477 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oor03000]     101289477 (NFKBIA)    04131 Membrane trafficking [BR:oor04131]     101289477 (NFKBIA) Transcription factors [BR:oor03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     101289477 (NFKBIA) Membrane trafficking [BR:oor04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101289477 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  101289477 NCBI-ProteinID:  XP_004270018 LinkDB All DBs Position 2:complement(138415093..138418667) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQVTEDGDSFLHLAIIHEEKVLTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgcggagcccggccaggagtgggccatggagggcccccgggacgcactc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaagagctaagggagatccgcctcgagcctcaggaggcgccg cgcggcgccgagccttggaagcagcaggtcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggtgctgaccatggaagtggtccgccaagtgaagggagac ctggcgttcctcaacttccagaacaacctgcagcagactcctctccacttggcggtgatc accaaccagccagagatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccttacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagccccgcgggacccagcacctccactccatcctacaagccaccaac tacaatggtcacacgtgtctgcatttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggtgctgatgtcaacgcacaggagccctgcaatggccgaactgcc ctccatctcgcggtggacctgcagaatcccgacctggtgtcgctcttgttgaagtgtggg gccgacgtcaacagggtcacctaccagggctactccccgtaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagatgctg cccgagagcgaggatgaggagagctatgacacggagtcagagttcacagaggatgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system