KEGG   Orcinus orca (killer whale): 105747731
Entry
105747731         CDS       T05247                                 
Name
(RefSeq) glutathione S-transferase theta-4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00480  Glutathione metabolism
oor00980  Metabolism of xenobiotics by cytochrome P450
oor00982  Drug metabolism - cytochrome P450
oor00983  Drug metabolism - other enzymes
oor01100  Metabolic pathways
oor01524  Platinum drug resistance
oor05200  Pathways in cancer
oor05204  Chemical carcinogenesis - DNA adducts
oor05207  Chemical carcinogenesis - receptor activation
oor05208  Chemical carcinogenesis - reactive oxygen species
oor05225  Hepatocellular carcinoma
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105747731
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105747731
   00982 Drug metabolism - cytochrome P450
    105747731
   00983 Drug metabolism - other enzymes
    105747731
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105747731
   05204 Chemical carcinogenesis - DNA adducts
    105747731
   05207 Chemical carcinogenesis - receptor activation
    105747731
   05208 Chemical carcinogenesis - reactive oxygen species
    105747731
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105747731
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105747731
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105747731
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oor02000]
    105747731
Enzymes [BR:oor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105747731
Transporters [BR:oor02000]
 Other transporters
  Pores ion channels [TC:1]
   105747731
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 DUF6589 GST_C_7 GST_C_2
Other DBs
NCBI-GeneID: 105747731
NCBI-ProteinID: XP_012390717
LinkDB
Position
15:64170795..64179383
AA seq 241 aa
MGLELYLDLLSASCRAVYIFARKNSIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDG
KFVLSESVAILFYLCRKYSAPSHWYPPDLHTRARVDEFMAWQHTALQLPMNKILWIKLLI
PMITGEEVPAEKTEQVLAEVTNNLKLFEEKFLQEKMFITGDNISLADLVALVEMMQPMAG
NHNVFLNSSKLAEWRMRVELAIGSDLFWEAHDRLVKLAEWDCSTLDPMVKERICDLLQKF
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtctgcatcgtgccgcgctgtctacatcttc
gccaggaagaacagcatccctttcgacttccagtttgtggatctgctgaaaggtcaccac
cacagcaaggagtacatcgagatcaaccccctgaggaagctgcccagtctcaaagatgga
aaatttgtcttatctgaaagtgtggccatccttttctacctgtgccgcaagtacagtgcg
ccctcgcactggtacccgccagacctgcacacgcgcgcccgcgtggacgagttcatggcc
tggcagcacacagcccttcagctgcccatgaacaagatactctggatcaagctgctgatc
ccgatgatcacgggtgaggaagttccagctgagaagacagagcaggtgctggcagaggtg
actaacaacctgaagctcttcgaggaaaagtttctgcaggagaagatgttcatcacaggg
gacaacatctccctggccgacttggtagccctggtggagatgatgcagcccatggcgggc
aaccataacgtcttcctcaacagctccaagctggccgagtggcgcatgagggtggagctg
gccatcggctccgacctcttctgggaggcccacgaccggctggtgaagttggcggagtgg
gactgctccacgctggatccgatggtcaaggagaggatctgcgatttgctgcagaagttc
acgtag

DBGET integrated database retrieval system