Orcinus orca (killer whale): 105747906 Help Entry 105747906         CDS       T05247                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism oor  Orcinus orca (killer whale) Pathway oor00190   Oxidative phosphorylation oor01100   Metabolic pathways oor01524   Platinum drug resistance oor04115   p53 signaling pathway oor04210   Apoptosis oor04215   Apoptosis - multiple species oor04932   Non-alcoholic fatty liver disease oor05010   Alzheimer disease oor05012   Parkinson disease oor05014   Amyotrophic lateral sclerosis oor05016   Huntington disease oor05017   Spinocerebellar ataxia oor05020   Prion disease oor05022   Pathways of neurodegeneration - multiple diseases oor05132   Salmonella infection oor05134   Legionellosis oor05145   Toxoplasmosis oor05152   Tuberculosis oor05160   Hepatitis C oor05161   Hepatitis B oor05162   Measles oor05163   Human cytomegalovirus infection oor05164   Influenza A oor05167   Kaposi sarcoma-associated herpesvirus infection oor05168   Herpes simplex virus 1 infection oor05169   Epstein-Barr virus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05210   Colorectal cancer oor05222   Small cell lung cancer oor05416   Viral myocarditis oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     105747906  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105747906    04215 Apoptosis - multiple species     105747906    04115 p53 signaling pathway     105747906  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105747906   09162 Cancer: specific types    05210 Colorectal cancer     105747906    05222 Small cell lung cancer     105747906   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105747906    05161 Hepatitis B     105747906    05160 Hepatitis C     105747906    05164 Influenza A     105747906    05162 Measles     105747906    05168 Herpes simplex virus 1 infection     105747906    05163 Human cytomegalovirus infection     105747906    05167 Kaposi sarcoma-associated herpesvirus infection     105747906    05169 Epstein-Barr virus infection     105747906   09171 Infectious disease: bacterial    05132 Salmonella infection     105747906    05134 Legionellosis     105747906    05152 Tuberculosis     105747906   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105747906   09164 Neurodegenerative disease    05010 Alzheimer disease     105747906    05012 Parkinson disease     105747906    05014 Amyotrophic lateral sclerosis     105747906    05016 Huntington disease     105747906    05017 Spinocerebellar ataxia     105747906    05020 Prion disease     105747906    05022 Pathways of neurodegeneration - multiple diseases     105747906   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105747906    05416 Viral myocarditis     105747906   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105747906   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105747906 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrom_C550 Cytochrome_CBB3 Motif Other DBs NCBI-GeneID:  105747906 NCBI-ProteinID:  XP_049571699 LinkDB All DBs Position 10:complement(20936362..21013098) Genome browser AA seq 172 aa AA seqDB search MPRDWAPANQRLRRAHRSPVSTPPSRWRRRASCAKLRQASPRRSRVAGSPGRRGLPLALP EKKKKKKKGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDAN KNKGITWGEETLMEYLENPKKYISGTKMIFTGIKKKGERADLIAYLEKATNE NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgccccgagattgggcgcccgccaaccaacggctgcggcgggcacacagaagcccagtg tccaccccgccctctcgctggcggcgccgagcgagctgcgctaagctccgccaggcgagc cctcggcgctcccgggtcgctggaagcccgggccggcgaggactccccctggcgctcccc gaaaaaaaaaaaaaaaaaaaaaagggtgatgttgagaagggaaagaagatttttgttcag aagtgtgcccagtgccatactgtggaaaagggaggcaagcacaagactgggccaaatctc catggcctgtttgggcgaaagacaggtcaggctgtcggattctcttacacagacgccaac aagaacaaaggcatcacctggggagaggagacactgatggagtatttggagaatcccaag aagtacatctctggaacaaaaatgatcttcactggcattaagaagaagggagaaagggca gacttgatagcttatctcgaaaaagctactaatgaataa

DBGET integrated database retrieval system