Orcinus orca (killer whale): 105748709 Help Entry 105748709         CDS       T05247                                  Symbol IL25 Name (RefSeq) interleukin-25   KO K05493   interleukin 17E Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105748709 (IL25)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     105748709 (IL25)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     105748709 (IL25) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interleukins    105748709 (IL25) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  105748709 NCBI-ProteinID:  XP_033267517 LinkDB All DBs Position 2:127444153..127448242 Genome browser AA seq 85 aa AA seqDB search MYQVVAFLAMVLGTHTLHLRPQKGCTHWPSCCPSKGQNPTEEWLKCNTVLMPPPETTSLA HHPESCKASEDGPLNSRSIAPWRYE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtaccaagtggttgcatttttggcaatggtcttgggaacccacacccttcatttgcgg ccccagaagggctgtacccactggcccagctgctgccccagcaaaggacagaaccccact gaggagtggctgaagtgcaacactgtgctcatgcctcccccagagaccaccagccttgcc caccacccggaatcctgcaaggccagtgaagacggacccctcaacagccggtccatcgcc ccctggagatacgaatga

DBGET integrated database retrieval system