Orcinus orca (killer whale): 117197913 Help Entry 117197913         CDS       T05247                                  Name (RefSeq) signal transducer CD24-like   KO K06469   CD24 antigen Organism oor  Orcinus orca (killer whale) Pathway oor04148   Efferocytosis oor04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:oor00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     117197913  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     117197913  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:oor04090]     117197913    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:oor00537]     117197913 CD molecules [BR:oor04090]  Proteins   117197913 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:oor00537]  Antigens   117197913 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD24 Motif Other DBs NCBI-GeneID:  117197913 NCBI-ProteinID:  XP_049552199 LinkDB All DBs Position 13:complement(24714078..24717364) Genome browser AA seq 96 aa AA seqDB search MIGYSSEKCDALHTDGADVSRTMVARLRLGLLLLVLLLPMQIYSNQTIVVTPSSNPSQNI SAAPNPANATIMSSDDAPQSTASLFMISVSLLHLCC NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgatcggctacagcagtgaaaaatgtgatgcgctacacactgatggagcggacgtgagc agaacgatggtggccaggctccgactggggctgctgcttctggtgctgctcttacctatg cagatttattcaaatcaaacaattgttgtaacaccttcaagtaacccctcccagaatatc tcagctgcccccaatccagccaatgccaccatcatgtcaagtgatgatgctccacagtca acagccagtctcttcatgatctcggtctcccttctacatctctgctgttaa

DBGET integrated database retrieval system