Orcinus orca (killer whale): 117198239 Help Entry 117198239         CDS       T05247                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism oor  Orcinus orca (killer whale) Pathway oor04068   FoxO signaling pathway oor04136   Autophagy - other oor04140   Autophagy - animal oor04621   NOD-like receptor signaling pathway oor04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     117198239  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117198239    04136 Autophagy - other     117198239  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     117198239    04622 RIG-I-like receptor signaling pathway     117198239  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     117198239    04121 Ubiquitin system [BR:oor04121]     117198239    03029 Mitochondrial biogenesis [BR:oor03029]     117198239 Membrane trafficking [BR:oor04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     117198239 Ubiquitin system [BR:oor04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    117198239 Mitochondrial biogenesis [BR:oor03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     117198239 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  117198239 NCBI-ProteinID:  XP_049559029 LinkDB All DBs Position 20:45112351..45113750 Genome browser AA seq 140 aa AA seqDB search MAEEPESSLQLPPSIAAEGEGPTEVSPETATPEPPSSAAVSPGTEEPAGDTRKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgaggaaccggagtcttcgctgcagcttcctccctcaattgctgctgaaggtgaa ggacccacggaggtctccccagaaacagccactccggagcccccttcttccgctgcagtc tctccgggaacagaagaacctgccggtgacaccaggaagaaaattgacatcctgctaaag gctgtgggagacactcctataatgaaaacaaagaaatgggctgtagagcgaacccgaacc atccaaggactcattgacttcatcaaaaagttccttaaactggtggcttcagaacagttg tttatttatgtgaatcagtcctttgccccctccccagaccaggaagttggaaccctctat gaatgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaggcatgggga tga

DBGET integrated database retrieval system