Orcinus orca (killer whale): 125961825 Help Entry 125961825         CDS       T05247                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism oor  Orcinus orca (killer whale) Pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04020   Calcium signaling pathway oor04022   cGMP-PKG signaling pathway oor04024   cAMP signaling pathway oor04070   Phosphatidylinositol signaling system oor04114   Oocyte meiosis oor04218   Cellular senescence oor04261   Adrenergic signaling in cardiomyocytes oor04270   Vascular smooth muscle contraction oor04371   Apelin signaling pathway oor04625   C-type lectin receptor signaling pathway oor04713   Circadian entrainment oor04720   Long-term potentiation oor04722   Neurotrophin signaling pathway oor04728   Dopaminergic synapse oor04740   Olfactory transduction oor04744   Phototransduction oor04750   Inflammatory mediator regulation of TRP channels oor04910   Insulin signaling pathway oor04912   GnRH signaling pathway oor04915   Estrogen signaling pathway oor04916   Melanogenesis oor04921   Oxytocin signaling pathway oor04922   Glucagon signaling pathway oor04924   Renin secretion oor04925   Aldosterone synthesis and secretion oor04970   Salivary secretion oor04971   Gastric acid secretion oor05010   Alzheimer disease oor05012   Parkinson disease oor05022   Pathways of neurodegeneration - multiple diseases oor05031   Amphetamine addiction oor05034   Alcoholism oor05133   Pertussis oor05152   Tuberculosis oor05163   Human cytomegalovirus infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05214   Glioma oor05417   Lipid and atherosclerosis oor05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     125961825    04015 Rap1 signaling pathway     125961825    04371 Apelin signaling pathway     125961825    04020 Calcium signaling pathway     125961825    04070 Phosphatidylinositol signaling system     125961825    04024 cAMP signaling pathway     125961825    04022 cGMP-PKG signaling pathway     125961825  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     125961825    04218 Cellular senescence     125961825  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125961825   09152 Endocrine system    04910 Insulin signaling pathway     125961825    04922 Glucagon signaling pathway     125961825    04912 GnRH signaling pathway     125961825    04915 Estrogen signaling pathway     125961825    04921 Oxytocin signaling pathway     125961825    04916 Melanogenesis     125961825    04924 Renin secretion     125961825    04925 Aldosterone synthesis and secretion     125961825   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     125961825    04270 Vascular smooth muscle contraction     125961825   09154 Digestive system    04970 Salivary secretion     125961825    04971 Gastric acid secretion     125961825   09156 Nervous system    04728 Dopaminergic synapse     125961825    04720 Long-term potentiation     125961825    04722 Neurotrophin signaling pathway     125961825   09157 Sensory system    04744 Phototransduction     125961825    04740 Olfactory transduction     125961825    04750 Inflammatory mediator regulation of TRP channels     125961825   09159 Environmental adaptation    04713 Circadian entrainment     125961825  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125961825   09162 Cancer: specific types    05214 Glioma     125961825   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125961825    05163 Human cytomegalovirus infection     125961825    05167 Kaposi sarcoma-associated herpesvirus infection     125961825   09171 Infectious disease: bacterial    05133 Pertussis     125961825    05152 Tuberculosis     125961825   09164 Neurodegenerative disease    05010 Alzheimer disease     125961825    05012 Parkinson disease     125961825    05022 Pathways of neurodegeneration - multiple diseases     125961825   09165 Substance dependence    05031 Amphetamine addiction     125961825    05034 Alcoholism     125961825   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125961825    05418 Fluid shear stress and atherosclerosis     125961825  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oor01009]     125961825   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     125961825    03036 Chromosome and associated proteins [BR:oor03036]     125961825   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oor04147]     125961825 Protein phosphatases and associated proteins [BR:oor01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      125961825 Membrane trafficking [BR:oor04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     125961825 Chromosome and associated proteins [BR:oor03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      125961825 Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    125961825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EF-hand_11 DUF1103 TerB Caleosin EFhand_Ca_insen DUF5580_M Dockerin_1 Fe_hyd_lg_C RloB DUF2267 Motif Other DBs NCBI-GeneID:  125961825 NCBI-ProteinID:  XP_049556814 LinkDB All DBs Position 17:34894728..34895265 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFLVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEIIREADIDGDDQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccagctgactgaagagcagattgcagaattcaaagaagctttttcactattt gacaaggatggtgatggaactataacaacaaaggagttgggaactgtaatgaggtctctt gggcagaatcccacagaagcagagttacaggacatgattaatgaggtggatgctgatggt aacggcacaattgacttcccggaatttctgacaatgatggcaagaaaaatgaaagacaca gacagtgaagaagaaattagagaagcattccttgtgtttgataaggatggtaatggctat attagtgcagcagagctccgccatgtgatgacaaaccttggagagaagttaacagatgaa gaggttgatgaaatcatcagggaagcagatattgatggtgatgatcaagtaaactatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system