Orcinus orca (killer whale): 125961827
Help
Entry
125961827 CDS
T05247
Name
(RefSeq) calmodulin-1-like
KO
K02183
calmodulin
Organism
oor
Orcinus orca (killer whale)
Pathway
oor04014
Ras signaling pathway
oor04015
Rap1 signaling pathway
oor04020
Calcium signaling pathway
oor04022
cGMP-PKG signaling pathway
oor04024
cAMP signaling pathway
oor04070
Phosphatidylinositol signaling system
oor04114
Oocyte meiosis
oor04218
Cellular senescence
oor04261
Adrenergic signaling in cardiomyocytes
oor04270
Vascular smooth muscle contraction
oor04371
Apelin signaling pathway
oor04625
C-type lectin receptor signaling pathway
oor04713
Circadian entrainment
oor04720
Long-term potentiation
oor04722
Neurotrophin signaling pathway
oor04728
Dopaminergic synapse
oor04740
Olfactory transduction
oor04744
Phototransduction
oor04750
Inflammatory mediator regulation of TRP channels
oor04910
Insulin signaling pathway
oor04912
GnRH signaling pathway
oor04915
Estrogen signaling pathway
oor04916
Melanogenesis
oor04921
Oxytocin signaling pathway
oor04922
Glucagon signaling pathway
oor04924
Renin secretion
oor04925
Aldosterone synthesis and secretion
oor04970
Salivary secretion
oor04971
Gastric acid secretion
oor05010
Alzheimer disease
oor05012
Parkinson disease
oor05022
Pathways of neurodegeneration - multiple diseases
oor05031
Amphetamine addiction
oor05034
Alcoholism
oor05133
Pertussis
oor05152
Tuberculosis
oor05163
Human cytomegalovirus infection
oor05167
Kaposi sarcoma-associated herpesvirus infection
oor05170
Human immunodeficiency virus 1 infection
oor05200
Pathways in cancer
oor05214
Glioma
oor05417
Lipid and atherosclerosis
oor05418
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
oor00001
]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
125961827
04015 Rap1 signaling pathway
125961827
04371 Apelin signaling pathway
125961827
04020 Calcium signaling pathway
125961827
04070 Phosphatidylinositol signaling system
125961827
04024 cAMP signaling pathway
125961827
04022 cGMP-PKG signaling pathway
125961827
09140 Cellular Processes
09143 Cell growth and death
04114 Oocyte meiosis
125961827
04218 Cellular senescence
125961827
09150 Organismal Systems
09151 Immune system
04625 C-type lectin receptor signaling pathway
125961827
09152 Endocrine system
04910 Insulin signaling pathway
125961827
04922 Glucagon signaling pathway
125961827
04912 GnRH signaling pathway
125961827
04915 Estrogen signaling pathway
125961827
04921 Oxytocin signaling pathway
125961827
04916 Melanogenesis
125961827
04924 Renin secretion
125961827
04925 Aldosterone synthesis and secretion
125961827
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
125961827
04270 Vascular smooth muscle contraction
125961827
09154 Digestive system
04970 Salivary secretion
125961827
04971 Gastric acid secretion
125961827
09156 Nervous system
04728 Dopaminergic synapse
125961827
04720 Long-term potentiation
125961827
04722 Neurotrophin signaling pathway
125961827
09157 Sensory system
04744 Phototransduction
125961827
04740 Olfactory transduction
125961827
04750 Inflammatory mediator regulation of TRP channels
125961827
09159 Environmental adaptation
04713 Circadian entrainment
125961827
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
125961827
09162 Cancer: specific types
05214 Glioma
125961827
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
125961827
05163 Human cytomegalovirus infection
125961827
05167 Kaposi sarcoma-associated herpesvirus infection
125961827
09171 Infectious disease: bacterial
05133 Pertussis
125961827
05152 Tuberculosis
125961827
09164 Neurodegenerative disease
05010 Alzheimer disease
125961827
05012 Parkinson disease
125961827
05022 Pathways of neurodegeneration - multiple diseases
125961827
09165 Substance dependence
05031 Amphetamine addiction
125961827
05034 Alcoholism
125961827
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
125961827
05418 Fluid shear stress and atherosclerosis
125961827
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:
oor01009
]
125961827
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
oor04131
]
125961827
03036 Chromosome and associated proteins [BR:
oor03036
]
125961827
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
oor04147
]
125961827
Protein phosphatases and associated proteins [BR:
oor01009
]
Protein serine/threonine phosphatases
Phosphoprotein phosphatases (PPPs)
Calcineurin (PPP3/ PP2B)
Regulatory subunits
125961827
Membrane trafficking [BR:
oor04131
]
Exocytosis
Small GTPases and associated proteins
Rab associated proteins
125961827
Chromosome and associated proteins [BR:
oor03036
]
Eukaryotic type
Centrosome formation proteins
Centrosome duplication proteins
Centriole replication proteins
125961827
Exosome [BR:
oor04147
]
Exosomal proteins
Exosomal proteins of colorectal cancer cells
125961827
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
EF-hand_7
EF-hand_1
EF-hand_6
EF-hand_8
EF-hand_5
AIF-1
EF-hand_9
EH
EF_EFCAB10_C
SPARC_Ca_bdg
UPF0154
EF-hand_11
DUF1103
TerB
Caleosin
EFhand_Ca_insen
DUF5580_M
Dockerin_1
Fe_hyd_lg_C
RloB
DUF2267
Motif
Other DBs
NCBI-GeneID:
125961827
NCBI-ProteinID:
XP_049556816
LinkDB
All DBs
Position
17:32795114..32795692
Genome browser
AA seq
149 aa
AA seq
DB search
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFLVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEIIREADIDGDDQVNYEEFVQMMTAK
NT seq
450 nt
NT seq
+upstream
nt +downstream
nt
atggctgaccagctgactgaagagcagattgcagaattcaaagaagctttttcactattt
gacaaggatggtgatggaactataacaacaaaggagttgggaactgtaatgaggtctctt
gggcagaatcccacagaagcagagttacaggacatgattaatgaggtggatgctgatggt
aacggcacaattgacttcccggaatttctgacaatgatggcaagaaaaatgaaagacaca
gacagtgaagaagaaattagagaagcattccttgtgtttgataaggatggtaatggctat
attagtgcagcagagctccgccatgtgatgacaaaccttggagagaagttaacagatgaa
gaggttgatgaaatcatcagggaagcagatattgatggtgatgatcaagtaaactatgaa
gagtttgtacaaatgatgacagcaaagtga
DBGET
integrated database retrieval system