Orcinus orca (killer whale): 125964702 Help Entry 125964702         CDS       T05247                                  Name (RefSeq) interferon alpha-3-like   KO K05414   interferon alpha Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04151   PI3K-Akt signaling pathway oor04217   Necroptosis oor04620   Toll-like receptor signaling pathway oor04621   NOD-like receptor signaling pathway oor04622   RIG-I-like receptor signaling pathway oor04623   Cytosolic DNA-sensing pathway oor04630   JAK-STAT signaling pathway oor04650   Natural killer cell mediated cytotoxicity oor04936   Alcoholic liver disease oor05152   Tuberculosis oor05160   Hepatitis C oor05161   Hepatitis B oor05162   Measles oor05163   Human cytomegalovirus infection oor05164   Influenza A oor05165   Human papillomavirus infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05168   Herpes simplex virus 1 infection oor05169   Epstein-Barr virus infection oor05170   Human immunodeficiency virus 1 infection oor05171   Coronavirus disease - COVID-19 oor05200   Pathways in cancer oor05320   Autoimmune thyroid disease oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125964702    04151 PI3K-Akt signaling pathway     125964702   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125964702  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125964702  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125964702    04621 NOD-like receptor signaling pathway     125964702    04622 RIG-I-like receptor signaling pathway     125964702    04623 Cytosolic DNA-sensing pathway     125964702    04650 Natural killer cell mediated cytotoxicity     125964702  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125964702   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125964702    05161 Hepatitis B     125964702    05160 Hepatitis C     125964702    05171 Coronavirus disease - COVID-19     125964702    05164 Influenza A     125964702    05162 Measles     125964702    05168 Herpes simplex virus 1 infection     125964702    05163 Human cytomegalovirus infection     125964702    05167 Kaposi sarcoma-associated herpesvirus infection     125964702    05169 Epstein-Barr virus infection     125964702    05165 Human papillomavirus infection     125964702   09171 Infectious disease: bacterial    05152 Tuberculosis     125964702   09163 Immune disease    05320 Autoimmune thyroid disease     125964702   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125964702   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125964702  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     125964702 Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interferons    125964702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  125964702 NCBI-ProteinID:  XP_049567042 LinkDB All DBs Position 6:50928703..50929279 Genome browser AA seq 181 aa AA seqDB search MAPTVSLLLALVLLSCHSNCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG FPQEAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQLTDLQ ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN L NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggccccaaccgtgtccttactcctggccctggtgctgctcagctgccactccaactgc tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc ctgcaacagatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggaggcgtttggaggcaaccagttccagaaggctcaagccatcgctgtcgtc catgagatgatccagcagaccttccagctcttcagcacagagggctcggctgccgcttgg gatgagaccctcctggacaagttctgcactgcactttatcagcagctcactgacctgcaa gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaagtacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacgaac ttgtaa

DBGET integrated database retrieval system