Orcinus orca (killer whale): 72909422 Help Entry 72909422          CDS       T05247                                  Symbol ND3, NKY04_mgp06 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism oor  Orcinus orca (killer whale) Pathway oor00190   Oxidative phosphorylation oor01100   Metabolic pathways oor04714   Thermogenesis oor04723   Retrograde endocannabinoid signaling oor05010   Alzheimer disease oor05012   Parkinson disease oor05014   Amyotrophic lateral sclerosis oor05016   Huntington disease oor05020   Prion disease oor05022   Pathways of neurodegeneration - multiple diseases oor05208   Chemical carcinogenesis - reactive oxygen species oor05415   Diabetic cardiomyopathy Module oor_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:oor00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     72909422 (ND3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     72909422 (ND3)   09159 Environmental adaptation    04714 Thermogenesis     72909422 (ND3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     72909422 (ND3)   09164 Neurodegenerative disease    05010 Alzheimer disease     72909422 (ND3)    05012 Parkinson disease     72909422 (ND3)    05014 Amyotrophic lateral sclerosis     72909422 (ND3)    05016 Huntington disease     72909422 (ND3)    05020 Prion disease     72909422 (ND3)    05022 Pathways of neurodegeneration - multiple diseases     72909422 (ND3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     72909422 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:oor03029]     72909422 (ND3) Enzymes [BR:oor01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      72909422 (ND3) Mitochondrial biogenesis [BR:oor03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     72909422 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 Motif Other DBs NCBI-GeneID:  72909422 NCBI-ProteinID:  YP_010417127 UniProt:  D5J794 LinkDB All DBs Position MT:9506..9851 Genome browser AA seq 115 aa AA seqDB search MNLLSTLLTNTTLALLLMLIAFWLPQLNAYAEKTSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEITLLLPLPWAIQTNNLTTMLLMALFLISLLATSLAYEWTQKGLEWNK NT seq 346 nt NT seq  +upstreamnt  +downstreamnt ataaaccttctatcaacactactaacaaacacgaccctagccctactactcatacttatt gccttttgactcccccaactaaacgcctatgcagaaaaaactagtccttatgagtgtggc tttgatccaataggatctgcccgcctacccttttccataaaattctttctagtggcaatt acttttctcctctttgacctagaaattactctcctactccccctgccctgagcaatccaa acaaataatctaacaacaatactcctcatagccttattcctaatctctctactagcaact agcctagcctatgaatgaacccaaaaaggcctagaatgaaataaat

DBGET integrated database retrieval system