Ogataea parapolymorpha: HPODL_00427 Help Entry HPODL_00427       CDS       T08137                                  Name (RefSeq) Cell division control protein 42   KO K04393   cell division control protein 42 Organism opa  Ogataea parapolymorpha Pathway opa04011   MAPK signaling pathway - yeast opa04144   Endocytosis opa04517   IgSF CAM signaling opa04518   Integrin signaling opa05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:opa00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     HPODL_00427   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     HPODL_00427    04518 Integrin signaling     HPODL_00427  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     HPODL_00427  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     HPODL_00427  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opa04131]     HPODL_00427    03036 Chromosome and associated proteins [BR:opa03036]     HPODL_00427   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opa04147]     HPODL_00427    04031 GTP-binding proteins [BR:opa04031]     HPODL_00427 Membrane trafficking [BR:opa04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     HPODL_00427  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     HPODL_00427   Macropinocytosis    Ras GTPases     HPODL_00427 Chromosome and associated proteins [BR:opa03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     HPODL_00427 Exosome [BR:opa04147]  Exosomal proteins   Exosomal proteins of microglial cells    HPODL_00427   Exosomal proteins of breast milk    HPODL_00427 GTP-binding proteins [BR:opa04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     HPODL_00427 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  25769898 NCBI-ProteinID:  XP_013935850 UniProt:  W1QH99 LinkDB All DBs Position III:complement(<453464..>454039) Genome browser AA seq 191 aa AA seqDB search MMTIKCVVVGDGAVGKTCLLISYTTNKFPEDYVPTVFDNYAVTVMIGDEPYTVGLFDTAG QEDYDRLRPLSYPQTDVFLICFSVVVPSSFDNVREKWFPEVSHHAPQVPCLIVGTQIDLR KDPTALSNLMRQGQKPITPQQGEKLAKDLKAVKYVECSALSQEGLKNVFDEAIVAALEPP VIKKAKKCTIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgatgacgataaaatgtgtcgtggtgggagacggagcagtcggtaagacatgtctgctc atctcctacaccaccaacaaattcccagaagattatgtcccaactgtcttcgacaactac gccgtgacggtcatgattggagacgagccatacaccgtggggttgtttgatacagcaggc caagaagattacgataggttgagaccactttcgtatcctcaaaccgacgtgtttctgatc tgtttttctgtggttgtgccttcgtcgttcgataacgttagagaaaaatggttccctgaa gttagccaccacgctccacaagttccgtgtctgattgttggtacccagatcgatcttcgc aaggaccctacagcgctctccaacctcatgagacaaggccagaagcctatcacgccacag cagggcgagaagcttgcgaaagacctgaaagccgtcaagtacgtcgaatgctctgccttg agccaggagggactcaagaacgtgttcgatgaggcaatcgtggctgcccttgagcctcca gtcatcaagaaggccaagaagtgcaccattctatga

DBGET integrated database retrieval system