Ogataea parapolymorpha: HPODL_05277 Help Entry HPODL_05277       CDS       T08137                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism opa  Ogataea parapolymorpha Brite KEGG Orthology (KO) [BR:opa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:opa03041]     HPODL_05277   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opa04052]     HPODL_05277 Spliceosome [BR:opa03041]  Complex B   Other components    Complex B specific factors     HPODL_05277 Cytokines and neuropeptides [BR:opa04052]  Neuropeptides   Unclassified    HPODL_05277 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  25774699 NCBI-ProteinID:  XP_013933089 UniProt:  W1Q9E0 LinkDB All DBs Position VI:complement(47640..47861) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKIRVKCLPTDTIGDFKKLLGLQIGTDPNKIVLKKGYMIFKDHISLDDY EIHDGMNLELYYS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagttgtatgcaatgaccggctcgggaaaaaaatcagggttaagtgtctgccg actgacaccataggagacttcaaaaagctcttaggcctccaaattggcacagaccccaac aaaatcgttctcaagaaagggtacatgattttcaaagaccatatttcgctagacgactac gagatccacgacggaatgaacctagaattatactattcataa

DBGET integrated database retrieval system