Oceanimonas pelagia: PU634_06035 Help Entry PU634_06035       CDS       T09373                                  Symbol ppiC Name (GenBank) peptidylprolyl isomerase PpiC   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism ope  Oceanimonas pelagia Brite KEGG Orthology (KO) [BR:ope00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ope03110]     PU634_06035 (ppiC) Enzymes [BR:ope01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      PU634_06035 (ppiC) Chaperones and folding catalysts [BR:ope03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     PU634_06035 (ppiC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 Motif Other DBs NCBI-ProteinID:  WMC11926 UniProt:  A0AA50KPC5 LinkDB All DBs Position 1270790..1271071 Genome browser AA seq 93 aa AA seqDB search MAKRACALHILVKTEAECQALKAQLDKGADFHQLAKKHSLCPSGKKGGDLGEFSKGDMVG PFDKAVFTGPELKVQGPVKTRFGYHLIKVLYRH NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcaaaacgtgcctgtgccctgcatattctggtaaaaaccgaggccgagtgtcaggcc ctcaaggcccagctcgacaagggggccgattttcaccagctcgccaaaaagcactccctc tgcccgtccggtaaaaagggcggtgatctgggcgaattcagcaagggcgacatggtcggc ccgtttgacaaggcggtgttcaccgggcccgagctcaaggtgcaggggccggttaaaacc cgttttggctatcatctgatcaaggtgctctaccgccactga

DBGET integrated database retrieval system