Oceanimonas pelagia: PU634_10565 Help Entry PU634_10565       CDS       T09373                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ope  Oceanimonas pelagia Brite KEGG Orthology (KO) [BR:ope00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ope03032]     PU634_10565    03036 Chromosome and associated proteins [BR:ope03036]     PU634_10565    03400 DNA repair and recombination proteins [BR:ope03400]     PU634_10565 DNA replication proteins [BR:ope03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PU634_10565 Chromosome and associated proteins [BR:ope03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PU634_10565 DNA repair and recombination proteins [BR:ope03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PU634_10565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  WMC09559 UniProt:  A0AA50KLC2 LinkDB All DBs Position 2213779..2214057 Genome browser AA seq 92 aa AA seqDB search MTVMTKREIIVAMAEAADISQVKAKAALEKFLDLTANSLAHGESVALSPLGTLKPVATAA RTYQGFGRETVVPAHYRVKFNPSQKLKEALKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgactgtgatgactaaacgcgaaatcattgttgctatggctgaggccgccgacatcagc caggttaaagctaaagctgcactggaaaagtttctggacctaactgcaaacagcttagcc cacggcgagtccgtcgccctgtctcctctgggtaccttgaaacccgttgctaccgctgct cgcacctatcagggctttggtcgtgagaccgtggttcctgcccattatcgggtgaagttc aacccgagccagaagctcaaggaagctctgaagcgttaa

DBGET integrated database retrieval system