KEGG   Oceanimonas pelagia: PU634_16010
Entry
PU634_16010       CDS       T09373                                 
Symbol
ilvG
Name
(GenBank) acetolactate synthase 2 catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ope  Oceanimonas pelagia
Pathway
ope00290  Valine, leucine and isoleucine biosynthesis
ope00650  Butanoate metabolism
ope00660  C5-Branched dibasic acid metabolism
ope00770  Pantothenate and CoA biosynthesis
ope01100  Metabolic pathways
ope01110  Biosynthesis of secondary metabolites
ope01210  2-Oxocarboxylic acid metabolism
ope01230  Biosynthesis of amino acids
Module
ope_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ope_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ope00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PU634_16010 (ilvG)
   00660 C5-Branched dibasic acid metabolism
    PU634_16010 (ilvG)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PU634_16010 (ilvG)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PU634_16010 (ilvG)
Enzymes [BR:ope01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     PU634_16010 (ilvG)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N POR_N TXD17-like_Trx
Other DBs
NCBI-ProteinID: WMC10556
UniProt: A0AA50QBX8
LinkDB
Position
3341239..3342888
AA seq 549 aa
MNGAQYIVQTLKQQGVTQIFGYPGGAIMPLYDALYDGGVDHLLCRHEQAAALGAVGYARA
SGQVGVCMATSGPGATNLITGLADAMLDSIPVVAITGQVPMAAIGTDAFQEVDVLGMSLS
CTKHSYLVENVEDLGDIIAEAFEVARSGRPGPVLIDVPKNIQVAPVEPRATVPCTTAPNT
LDEAALAEAKALLAAARQPVLYVGGGVGMANAEAELRAFAEQSGIPAVTTLKGIGTLNPD
HELFLGMLGMHGTKAANLAVQQSDLLMVVGARFDDRVTGKLDAFAVNARVIHLDKDAAEF
GKVRHAHVGIDAELTEVLPRLTGERLAIDPWREQCRALKDEHQWRYDHPGEGIFAPLMLK
QLSEALDDTAMVSCDVGQHQMWVAQHMRFTSPRNHLSSAGLGTMGFGLPAAIGAKLARPE
HESVLVSGDGSFMMNVQELGTLKRAQLPVKMVLLDNQRLGMVRQWQELFFDGRFSETILT
DNPDFVAMAAAFGIPGETITRKEQVQPAIARMLQSDTAYLLHVRISEEENVWPLVPPGVA
NDQMMESKA
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgaatggcgcacagtacattgtccagacactgaaacaacaaggggtcacccagatcttc
ggttaccccggcggcgccatcatgccgctttacgacgccctctacgacggcggtgtggac
catctgctgtgccggcatgagcaggccgccgccctgggcgcggtgggctatgccagagcc
agtggtcaggtgggggtgtgcatggctacctccggccccggcgccaccaacctgatcacc
ggtctggccgacgccatgctcgactccattccggtggtggccatcaccggccaggtgccc
atggccgccatcggcaccgacgcctttcaggaagtggacgtgctgggcatgtcgctgtcc
tgcacaaaacactcttatctggtagagaacgtggaagatcttggcgacatcatcgccgaa
gcctttgaagtggcccgttctggtcgtcccggcccggtgcttatcgatgtgcccaaaaac
attcaggtcgcgccggtggagccccgtgccaccgtgccctgtaccacggcacccaatacc
ctcgacgaggccgccctggccgaagccaaggcgctgctggcggcggcgcgtcagccggtg
ctgtacgtggggggcggcgtgggcatggccaatgccgaggcagaattacgtgcttttgcc
gagcaaagcgggattcccgcggtcaccaccctgaagggcatcggcacgctgaatccggac
catgagctgtttttgggcatgctgggcatgcacggaacaaaagccgccaacctggcggtt
caacagagcgatctgctgatggtggtcggcgcccgtttcgacgatcgggtcaccggcaag
cttgatgccttcgcggtcaatgccagggtgatccacctggacaaggacgccgccgagttt
ggcaaggtgcgccatgcccatgtggggatcgatgccgagctgaccgaggtattgccgcgg
cttaccggcgagcggctggccatcgacccctggcgtgagcagtgcagggcgctcaaggac
gagcaccagtggcgttacgaccacccgggcgaaggcatttttgcaccgctgatgctcaag
caactgagcgaggcgctggacgacaccgccatggtcagctgcgacgtgggtcagcaccag
atgtgggtggcccagcacatgcgctttaccagcccgcgcaaccacctcagcagtgccggc
ctgggtaccatgggctttggcctgcccgccgccattggtgccaagctggcccgccccgag
cacgagtcggtactggtgtccggtgacggctccttcatgatgaatgtgcaggagctgggt
accctcaaacgcgcccagctgccggtgaagatggtactgctcgacaaccagcgcctgggc
atggtgcgccagtggcaggagctgttcttcgacggccgcttcagtgaaaccattttgacc
gacaacccggatttcgtggccatggccgctgcctttggcattccgggcgaaaccattacc
cgcaaggagcaggtgcagcccgccatcgcgcgcatgctgcagtccgacaccgcctacctg
ctgcacgtgcgtatttcagaggaagagaacgtctggcccctggtgccgccgggcgttgcc
aacgatcaaatgatggagagcaaagcatga

DBGET integrated database retrieval system