Obesumbacterium proteus: DSM2777_11550 Help Entry DSM2777_11550     CDS       T04310                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism opo  Obesumbacterium proteus Pathway opo01100   Metabolic pathways opo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:opo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM2777_11550    00074 Mycolic acid biosynthesis     DSM2777_11550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM2777_11550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AMO81606 LinkDB All DBs Position 2426137..2426388 Genome browser AA seq 83 aa AA seqDB search MSQYDVIYAKVSEMIADAKDLECEDIQADAPLALLSLDSLDYVELIILAKREFGVTLTAE LFIQHPNITLREVCEFIDKESVA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccagtatgatgttatctatgcaaaagtcagtgagatgattgccgatgccaaagat ttagagtgcgaagatattcaggccgatgcgcctcttgcgcttctttctctggatagtttg gactacgtagaattgattatcttagccaagcgagagttcggcgtgaccttaaccgccgaa ctctttattcagcatcccaatattaccttgcgcgaagtgtgtgagtttattgataaggag tcagtggcctaa

DBGET integrated database retrieval system