Obesumbacterium proteus: DSM2777_14730 Help Entry DSM2777_14730     CDS       T04310                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism opo  Obesumbacterium proteus Pathway opo01100   Metabolic pathways opo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:opo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM2777_14730    00074 Mycolic acid biosynthesis     DSM2777_14730   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM2777_14730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AMO82170 LinkDB All DBs Position 3097248..3097484 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIIEQLGVKEDEVVNAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYIESANK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattatcgaacagctgggtgttaaagaa gacgaagtcgtgaatgctgcttccttcgttgacgatctgggtgctgattctcttgacacc gttgaactggttatggctctggaagaagagtttgatactgagattccggacgaagaagca gaaaagatcactactgttcaagcagcaatcgactacatcgaatctgcgaacaagtaa

DBGET integrated database retrieval system