Brucella pseudogrignonensis: A8A54_02100 Help Entry A8A54_02100       CDS       T04415                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ops  Brucella pseudogrignonensis Pathway ops01100   Metabolic pathways ops01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ops00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A8A54_02100    00074 Mycolic acid biosynthesis     A8A54_02100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A8A54_02100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ANG95389 UniProt:  A0A1A9FI23 LinkDB All DBs Position 1:444090..444326 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgagcatctgggtgtagatgcc gacaaggtcaccgaaggcgcaagcttcattgatgatcttggtgcagacagcctcgacacc gtcgagctggtcatggctttcgaagaagaattcggcgttgaaattcctgacgacgctgca gaaacgatcctcacggtcggcgacgctgtgaagttcatcgataaggcatccgcctaa

DBGET integrated database retrieval system