Oricola thermophila: HTY61_08150 Help Entry HTY61_08150       CDS       T06643                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism orm  Oricola thermophila Pathway orm01100   Metabolic pathways orm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:orm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HTY61_08150    00074 Mycolic acid biosynthesis     HTY61_08150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HTY61_08150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QKV18425 UniProt:  A0A6N1VFP3 LinkDB All DBs Position complement(1678544..1678780) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVEHLGVDAEKVNEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIEKANA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagaacgggtcaagaagatcgttgttgaacatttgggcgtcgatgcc gagaaggtgaatgaaggtgcaagcttcattgacgaccttggcgccgacagccttgatacc gtcgaactggtgatggcgttcgaagaggagttcggtgtcgaaatccccgacgatgcggcc gagaccatcctgacagtcggcgacgccgtgaaattcattgaaaaagccaacgcctga

DBGET integrated database retrieval system