Oricola thermophila: HTY61_10970 Help Entry HTY61_10970       CDS       T06643                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism orm  Oricola thermophila Pathway orm00190   Oxidative phosphorylation orm01100   Metabolic pathways Module orm_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:orm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HTY61_10970  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:orm00194]     HTY61_10970 Photosynthesis proteins [BR:orm00194]  Photosystem and electron transport system   F-type ATPase [OT]    HTY61_10970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QKV18936 UniProt:  A0A6N1VDH9 LinkDB All DBs Position complement(2256210..2256437) Genome browser AA seq 75 aa AA seqDB search MEAEAAKFIGAGIACLGMGGAGIGLGTIFGNYLSGALRNPSAADGQFGRLIFGFAVTEAL GIFSLLVALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaagcggaagcagcaaagttcatcggtgcaggtatcgcgtgccttggcatgggtggc gcgggcatcggcctcggcacgatcttcggcaactacctgtcgggcgccctgcgcaacccg tcggctgccgacggccagttcggccgcctgatcttcggcttcgccgtgacggaagccttg ggcatcttctccctgctcgtcgcgctcctgctgctcttcgcagtctga

DBGET integrated database retrieval system