Ornithinimicrobium avium: DV701_01575 Help Entry DV701_01575       CDS       T05559                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism orn  Ornithinimicrobium avium Pathway orn01100   Metabolic pathways orn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:orn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DV701_01575    00074 Mycolic acid biosynthesis     DV701_01575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DV701_01575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXH95028 UniProt:  A0A345NJ20 LinkDB All DBs Position complement(336722..336970) Genome browser AA seq 82 aa AA seqDB search MALSEQEILSGLAEIVNEETGLEPEEVQMEKSFTEDLDIDSLSMMTIVVNAEDKFGVRIP DDEVKNLTHVKDAVTYIANNQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctctgagcgagcaggagatcctctcgggtctcgccgagatcgtcaacgaggagacg ggcctggagcccgaggaggtccagatggagaagtccttcaccgaggacctggacatcgac tccctgtcgatgatgacgatcgtggtcaacgccgaggacaagttcggcgtccgcatcccc gacgacgaggtcaagaacctcacccacgtcaaggacgcggtcacctacatcgcgaacaac cagggctga

DBGET integrated database retrieval system