KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370917
Entry
101370917         CDS       T05148                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04927  Cortisol synthesis and secretion
oro04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101370917 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101370917 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4
Other DBs
NCBI-GeneID: 101370917
NCBI-ProteinID: XP_012419894
UniProt: A0A2U3ZLM2
LinkDB
Position
Unknown
AA seq 120 aa
MANQTNASTLYNSYEYYLDYLDLIPVDERKLKANKYLIVITFWASLAFFVMLLFLILLYM
SWSGSSQARNNAQHHPTCPWSNSPHLPLCFRRHPPRLHRASADIRNTRGEPPPGDRTSQL
NT seq 363 nt   +upstreamnt  +downstreamnt
atggccaaccagaccaacgcctccaccctgtacaacagctacgaatactacctggactac
ttggacctcattcccgtggatgagaggaagctgaaagccaacaaatatttgattgtcatc
accttctgggcgagcctggcattcttcgtcatgcttctcttcctcatcctgctctacatg
tcctggtcaggctcctcacaggcgaggaacaatgcccagcaccacccaacatgcccctgg
agtaacagcccccacctccccctctgcttccggaggcaccccccaaggctccaccgagca
tcagctgacatcaggaacacgcggggtgagccgccccctggagacagaacctctcaactg
tag

DBGET integrated database retrieval system