KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372573
Entry
101372573         CDS       T05148                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04114  Oocyte meiosis
oro04140  Autophagy - animal
oro04148  Efferocytosis
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04270  Vascular smooth muscle contraction
oro04350  TGF-beta signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04520  Adherens junction
oro04540  Gap junction
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04713  Circadian entrainment
oro04720  Long-term potentiation
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04724  Glutamatergic synapse
oro04725  Cholinergic synapse
oro04726  Serotonergic synapse
oro04730  Long-term depression
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04921  Oxytocin signaling pathway
oro04926  Relaxin signaling pathway
oro04928  Parathyroid hormone synthesis, secretion and action
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro05010  Alzheimer disease
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05034  Alcoholism
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05207  Chemical carcinogenesis - receptor activation
oro05208  Chemical carcinogenesis - reactive oxygen species
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05216  Thyroid cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101372573 (MAPK1)
   04012 ErbB signaling pathway
    101372573 (MAPK1)
   04014 Ras signaling pathway
    101372573 (MAPK1)
   04015 Rap1 signaling pathway
    101372573 (MAPK1)
   04350 TGF-beta signaling pathway
    101372573 (MAPK1)
   04370 VEGF signaling pathway
    101372573 (MAPK1)
   04371 Apelin signaling pathway
    101372573 (MAPK1)
   04668 TNF signaling pathway
    101372573 (MAPK1)
   04066 HIF-1 signaling pathway
    101372573 (MAPK1)
   04068 FoxO signaling pathway
    101372573 (MAPK1)
   04072 Phospholipase D signaling pathway
    101372573 (MAPK1)
   04071 Sphingolipid signaling pathway
    101372573 (MAPK1)
   04024 cAMP signaling pathway
    101372573 (MAPK1)
   04022 cGMP-PKG signaling pathway
    101372573 (MAPK1)
   04151 PI3K-Akt signaling pathway
    101372573 (MAPK1)
   04150 mTOR signaling pathway
    101372573 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101372573 (MAPK1)
   04148 Efferocytosis
    101372573 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101372573 (MAPK1)
   04210 Apoptosis
    101372573 (MAPK1)
   04218 Cellular senescence
    101372573 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101372573 (MAPK1)
   04520 Adherens junction
    101372573 (MAPK1)
   04540 Gap junction
    101372573 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101372573 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101372573 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101372573 (MAPK1)
   04613 Neutrophil extracellular trap formation
    101372573 (MAPK1)
   04620 Toll-like receptor signaling pathway
    101372573 (MAPK1)
   04621 NOD-like receptor signaling pathway
    101372573 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    101372573 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    101372573 (MAPK1)
   04660 T cell receptor signaling pathway
    101372573 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    101372573 (MAPK1)
   04659 Th17 cell differentiation
    101372573 (MAPK1)
   04657 IL-17 signaling pathway
    101372573 (MAPK1)
   04662 B cell receptor signaling pathway
    101372573 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    101372573 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    101372573 (MAPK1)
   04062 Chemokine signaling pathway
    101372573 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101372573 (MAPK1)
   04929 GnRH secretion
    101372573 (MAPK1)
   04912 GnRH signaling pathway
    101372573 (MAPK1)
   04915 Estrogen signaling pathway
    101372573 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    101372573 (MAPK1)
   04917 Prolactin signaling pathway
    101372573 (MAPK1)
   04921 Oxytocin signaling pathway
    101372573 (MAPK1)
   04926 Relaxin signaling pathway
    101372573 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    101372573 (MAPK1)
   04919 Thyroid hormone signaling pathway
    101372573 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    101372573 (MAPK1)
   04916 Melanogenesis
    101372573 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101372573 (MAPK1)
   04270 Vascular smooth muscle contraction
    101372573 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101372573 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101372573 (MAPK1)
   04725 Cholinergic synapse
    101372573 (MAPK1)
   04726 Serotonergic synapse
    101372573 (MAPK1)
   04720 Long-term potentiation
    101372573 (MAPK1)
   04730 Long-term depression
    101372573 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    101372573 (MAPK1)
   04722 Neurotrophin signaling pathway
    101372573 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    101372573 (MAPK1)
   04380 Osteoclast differentiation
    101372573 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101372573 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101372573 (MAPK1)
   05206 MicroRNAs in cancer
    101372573 (MAPK1)
   05205 Proteoglycans in cancer
    101372573 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    101372573 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    101372573 (MAPK1)
   05203 Viral carcinogenesis
    101372573 (MAPK1)
   05230 Central carbon metabolism in cancer
    101372573 (MAPK1)
   05231 Choline metabolism in cancer
    101372573 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101372573 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101372573 (MAPK1)
   05212 Pancreatic cancer
    101372573 (MAPK1)
   05225 Hepatocellular carcinoma
    101372573 (MAPK1)
   05226 Gastric cancer
    101372573 (MAPK1)
   05214 Glioma
    101372573 (MAPK1)
   05216 Thyroid cancer
    101372573 (MAPK1)
   05221 Acute myeloid leukemia
    101372573 (MAPK1)
   05220 Chronic myeloid leukemia
    101372573 (MAPK1)
   05218 Melanoma
    101372573 (MAPK1)
   05211 Renal cell carcinoma
    101372573 (MAPK1)
   05219 Bladder cancer
    101372573 (MAPK1)
   05215 Prostate cancer
    101372573 (MAPK1)
   05213 Endometrial cancer
    101372573 (MAPK1)
   05224 Breast cancer
    101372573 (MAPK1)
   05223 Non-small cell lung cancer
    101372573 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101372573 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    101372573 (MAPK1)
   05161 Hepatitis B
    101372573 (MAPK1)
   05160 Hepatitis C
    101372573 (MAPK1)
   05171 Coronavirus disease - COVID-19
    101372573 (MAPK1)
   05164 Influenza A
    101372573 (MAPK1)
   05163 Human cytomegalovirus infection
    101372573 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101372573 (MAPK1)
   05165 Human papillomavirus infection
    101372573 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101372573 (MAPK1)
   05135 Yersinia infection
    101372573 (MAPK1)
   05133 Pertussis
    101372573 (MAPK1)
   05152 Tuberculosis
    101372573 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101372573 (MAPK1)
   05140 Leishmaniasis
    101372573 (MAPK1)
   05142 Chagas disease
    101372573 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101372573 (MAPK1)
   05020 Prion disease
    101372573 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    101372573 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    101372573 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101372573 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101372573 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101372573 (MAPK1)
   04934 Cushing syndrome
    101372573 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101372573 (MAPK1)
   01524 Platinum drug resistance
    101372573 (MAPK1)
   01522 Endocrine resistance
    101372573 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101372573 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101372573 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101372573 (MAPK1)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101372573 (MAPK1)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101372573 (MAPK1)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101372573 (MAPK1)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101372573 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101372573
NCBI-ProteinID: XP_004400572
UniProt: A0A2U3VYF5
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccacgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgaa
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccatccgtatctggagcagtattatgacccaagc
gatgagcccatcgctgaggcgccattcaagtttgacatggagctggatgacctgcccaag
gaaaagctcaaagagctcatctttgaagagacagctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system