KEGG   Odobenus rosmarus divergens (Pacific walrus): 101373722
Entry
101373722         CDS       T05148                                 
Name
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04270  Vascular smooth muscle contraction
oro04371  Apelin signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04713  Circadian entrainment
oro04720  Long-term potentiation
oro04722  Neurotrophin signaling pathway
oro04728  Dopaminergic synapse
oro04740  Olfactory transduction
oro04744  Phototransduction
oro04750  Inflammatory mediator regulation of TRP channels
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04921  Oxytocin signaling pathway
oro04922  Glucagon signaling pathway
oro04924  Renin secretion
oro04925  Aldosterone synthesis and secretion
oro04970  Salivary secretion
oro04971  Gastric acid secretion
oro05010  Alzheimer disease
oro05012  Parkinson disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05133  Pertussis
oro05152  Tuberculosis
oro05163  Human cytomegalovirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05214  Glioma
oro05417  Lipid and atherosclerosis
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101373722
   04015 Rap1 signaling pathway
    101373722
   04371 Apelin signaling pathway
    101373722
   04020 Calcium signaling pathway
    101373722
   04070 Phosphatidylinositol signaling system
    101373722
   04024 cAMP signaling pathway
    101373722
   04022 cGMP-PKG signaling pathway
    101373722
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101373722
   04218 Cellular senescence
    101373722
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101373722
  09152 Endocrine system
   04910 Insulin signaling pathway
    101373722
   04922 Glucagon signaling pathway
    101373722
   04912 GnRH signaling pathway
    101373722
   04915 Estrogen signaling pathway
    101373722
   04921 Oxytocin signaling pathway
    101373722
   04916 Melanogenesis
    101373722
   04924 Renin secretion
    101373722
   04925 Aldosterone synthesis and secretion
    101373722
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101373722
   04270 Vascular smooth muscle contraction
    101373722
  09154 Digestive system
   04970 Salivary secretion
    101373722
   04971 Gastric acid secretion
    101373722
  09156 Nervous system
   04728 Dopaminergic synapse
    101373722
   04720 Long-term potentiation
    101373722
   04722 Neurotrophin signaling pathway
    101373722
  09157 Sensory system
   04744 Phototransduction
    101373722
   04740 Olfactory transduction
    101373722
   04750 Inflammatory mediator regulation of TRP channels
    101373722
  09159 Environmental adaptation
   04713 Circadian entrainment
    101373722
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101373722
  09162 Cancer: specific types
   05214 Glioma
    101373722
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101373722
   05163 Human cytomegalovirus infection
    101373722
   05167 Kaposi sarcoma-associated herpesvirus infection
    101373722
  09171 Infectious disease: bacterial
   05133 Pertussis
    101373722
   05152 Tuberculosis
    101373722
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101373722
   05012 Parkinson disease
    101373722
   05022 Pathways of neurodegeneration - multiple diseases
    101373722
  09165 Substance dependence
   05031 Amphetamine addiction
    101373722
   05034 Alcoholism
    101373722
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101373722
   05418 Fluid shear stress and atherosclerosis
    101373722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101373722
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101373722
   03036 Chromosome and associated proteins [BR:oro03036]
    101373722
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101373722
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101373722
Membrane trafficking [BR:oro04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    101373722
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     101373722
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101373722
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EF_EFCAB10_C EH SPARC_Ca_bdg UPF0154 EF-hand_11 EFhand_Ca_insen SAPC2_N EF-hand_EFHB_C TerB Caleosin FCaBP_EF-hand DUF1103 DUF5580_M SPEF2_C EF-hand_STIM1 PA_Ig-like
Other DBs
NCBI-GeneID: 101373722
NCBI-ProteinID: XP_004401226
UniProt: A0A2U3W067
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDCQVNYEEFVQVMTAR
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccagctgactgaggagcagatcgcagagttcaaggaggccttctccctcttt
gacaaggatggagatggaactatcaccaccaaggagttggggacagtgatgagatccctg
ggacagaaccccaccgaagcagagctacaggacatgatcaatgaggtggatgcagatggg
aatgggaccattgacttcccggagttcctgaccatgatggccagaaagatgaaggataca
gacagcgaggaggagatccgagaggcgttccgtgtctttgacaaggacggcaatggctac
atcagcgctgccgagctgcgtcacgtaatgacgaacctgggtgagaagctgaccgatgag
gaggtggacgagatgatcagagaggccgacatcgatggagactgccaggtcaattacgaa
gagtttgtacaggtgatgactgccaggtga

DBGET integrated database retrieval system