Oceanicoccus sagamiensis: BST96_16330 Help Entry BST96_16330       CDS       T04832                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism osg  Oceanicoccus sagamiensis Pathway osg00998   Biosynthesis of various antibiotics osg01100   Metabolic pathways osg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:osg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BST96_16330    00074 Mycolic acid biosynthesis     BST96_16330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BST96_16330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 TerB Fas_alpha_ACP HLH Motif Other DBs NCBI-ProteinID:  ARN75536 UniProt:  A0A1X9ND93 LinkDB All DBs Position 3594966..3595202 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEDEVQTSASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EQITTVQLAIDYINKNLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgcgtaaagaaaattgttgcagagcaactaggtgttaaagaa gacgaagtacagacctcagcttcttttgtagaagatttgggtgcagattcactggacacc gttgaattggtaatggctctggaagaagaattcgaaactgaaattcctgatgaagaagcc gagcaaattactactgttcagttggctatcgactatatcaacaaaaacctgggttaa

DBGET integrated database retrieval system