Oenococcus sicerae: DLJ48_06510 Help Entry DLJ48_06510       CDS       T05833                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism osi  Oenococcus sicerae Pathway osi00362   Benzoate degradation osi00622   Xylene degradation osi01100   Metabolic pathways osi01120   Microbial metabolism in diverse environments osi01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:osi00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     DLJ48_06510    00622 Xylene degradation     DLJ48_06510    00621 Dioxin degradation     DLJ48_06510 Enzymes [BR:osi01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      DLJ48_06510 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF5356 Tiggrin_N Motif Other DBs NCBI-ProteinID:  QAS70647 UniProt:  A0ABX5QPJ7 LinkDB All DBs Position 1255381..1255566 Genome browser AA seq 61 aa AA seqDB search MPYIQIDMLEGRSHKQIKKIVKDITEVMVQDANAKAEAVHIVVRESKTDHIAAAGILKSE M NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccatatattcaaattgatatgttggaaggacgctcgcacaagcaaattaaaaaaata gtgaaagatattacggaagtaatggtgcaagatgccaatgcaaaagctgaagctgttcac attgtcgttcgtgaatccaaaacagatcatattgctgctgctgggattttaaaatctgaa atgtaa

DBGET integrated database retrieval system