KEGG   Ostreococcus tauri: OT_ostta02g02740
Entry
OT_ostta02g02740  CDS       T01358                                 
Name
(RefSeq) RNA exonuclease
  KO
K18327  RNA exonuclease 4 [EC:3.1.-.-]
Organism
ota  Ostreococcus tauri
Brite
KEGG Orthology (KO) [BR:ota00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ota03009]
    OT_ostta02g02740
Ribosome biogenesis [BR:ota03009]
 Eukaryotic type
  90S particles
   RNase
    OT_ostta02g02740
SSDB
Motif
Pfam: RNase_H RNase_T SOCS_box
Other DBs
NCBI-GeneID: 9837048
NCBI-ProteinID: XP_022840773
OrcAE: OT_ostta02g02740
UniProt: A0A090M7P4
LinkDB
Position
2:complement(561988..563415)
AA seq 475 aa
MGVGRWFVVWRLRLELLVFLCRFVIVRTLGRWVPSLKRLFSSLFPDVRVSCAPTEVAKGR
RGASGSSRVEQCHVDGGVELERGRSGVGVWYAYGHRLNYAASASGRSMDNNAVEMCAVYA
ALSRHDGEAPLELRSDSRWVCKALERLTSGNVVGMRVNAVTIGAAFVLSQRTGGTIIQKV
RAHVGGNHTDNARADQLAAVGMRSTEEPSFVPDASDKDGFFHLVRALWRADVVRALTERF
IVRSPATGNGCIDGTGSSEERRKAHTDVSRNVKKMDGVKELVRPKPLNNDFSITDVLALD
CEMVGVGDGGLESILAQVCVLNEHGNTVYTSYSRAYRAVTDYRTQVSGISQRHVDESAPE
FHKVRCTVAELIKGRVVVGHALENDFKALQLHHPREDVRDTAVWRPLLRPPRFLKPRRLR
HLARDFVSLKIQCGDSHDPAEDALAALYIYRRFKDEWEGQIAASEQGKRKPQRDV
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgggcgttggaagatggttcgtcgtttggcggctgcggctcgagttgttggtttttctc
tgtcgcttcgtcatcgttcgaacgcttgggagatgggtgccgtcgctcaagcgattgttt
tcgagcctattccccgacgtccgagtgtcgtgtgcgcccacggaggtggcgaagggacga
cgcggcgcgagcggcagttcgcgcgtcgagcagtgtcacgtcgacgggggagtcgagctc
gagcgaggacgttcgggtgtgggggtgtggtatgcgtacgggcataggttgaattacgct
gcgagtgcgtcggggcggtcgatggataataacgcggtggagatgtgcgcggtgtacgcg
gcgctgagtcggcacgatggcgaggcgccgctcgagttgaggagtgattcgaggtgggta
tgcaaggcgctcgagaggttgacgtcggggaacgtggttggaatgcgagtgaacgcagtg
acgatcggggcggcgtttgtgttgagccaacgaacggggggtacgattattcaaaaggtg
cgcgcgcacgtaggcgggaatcacactgacaacgccagggcggatcagctcgcggcggta
gggatgcgatcgaccgaagagccgtctttcgttccggacgcaagtgataaggacggattc
tttcatctcgtgcgcgcgttgtggcgagcggacgtggtgagagcgttgacagagcgcttc
atcgtgcgctcgccggcgaccgggaacgggtgcatcgacggaaccggatcgagcgaggag
cgaaggaaggcgcacacggacgtgagtagaaacgtcaaaaagatggacggtgttaaagag
ctcgttcgaccgaagccattgaacaatgacttttcgattacggatgtcttggcgcttgat
tgcgagatggtcggtgttggcgacggcggattagagagcattcttgcccaagtttgcgtc
cttaacgagcacggaaataccgtatacacgtcttatagccgtgcctacagggctgtcacc
gattatcgcacgcaagtgtcgggtatttcacagagacacgtggacgagagcgcaccggag
tttcacaaggtccggtgcacagttgctgagctcattaaggggcgcgtcgtcgtcggtcac
gcgctcgagaacgatttcaaagcactccaactccatcatcctcgagaggacgttcgcgac
accgcggtttggcgcccgcttcttcgtccaccgagattcctcaagcctcgaaggctcagg
cacctcgctcgggattttgtctcgctcaagatacagtgcggcgactcccacgatcccgcc
gaggacgccctcgctgcgctgtacatctaccgtaggttcaaggatgagtgggagggtcag
atagccgcctcggaacagggcaagcgcaagccacagcgcgacgtgtaa

DBGET integrated database retrieval system