Ostreococcus tauri: OT_ostta03g02490 Help Entry OT_ostta03g02490  CDS       T01358                                  Name (RefSeq) Apc13p   KO K12456   anaphase-promoting complex subunit 13 Organism ota  Ostreococcus tauri Pathway ota04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ota00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     OT_ostta03g02490  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ota04121]     OT_ostta03g02490    03036 Chromosome and associated proteins [BR:ota03036]     OT_ostta03g02490 Ubiquitin system [BR:ota04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      OT_ostta03g02490 Chromosome and associated proteins [BR:ota03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     OT_ostta03g02490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apc13p Motif Other DBs NCBI-GeneID:  34945676 NCBI-ProteinID:  XP_022838493 OrcAE:  OT_ostta03g02490 UniProt:  A0A090N2X2 LinkDB All DBs Position 3:complement(402665..403111) Genome browser AA seq 68 aa AA seqDB search MDDATPLERWRASDVVDDEWANDRLPDDEVQLRAEMTPPVDDAEEANETAGMESGEDEWK DLGLQEAG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggacgacgcgacgccgctcgagcgctggcgcgcctcggacgtcgtcgacgacgaatgg gcgaacgatcggttaccggacgacgaggtacagctgcgcgcggagatgaccccgccggtg gatgacgcggaggaggcgaacgagacggctgggatggaaagtggagaggatgagtggaaa gatttgggcctccaagaagcgggatga

DBGET integrated database retrieval system