Ostreococcus tauri: OT_ostta10g00840 Help Entry OT_ostta10g00840  CDS       T01358                                  Name (RefSeq) Ubiquitin supergroup   KO K13113   ubiquitin-like protein 5 Organism ota  Ostreococcus tauri Brite KEGG Orthology (KO) [BR:ota00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ota03041]     OT_ostta10g00840   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ota04052]     OT_ostta10g00840 Spliceosome [BR:ota03041]  Complex B   Other components    Complex B specific factors     OT_ostta10g00840 Cytokines and neuropeptides [BR:ota04052]  Neuropeptides   Unclassified    OT_ostta10g00840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  34946178 NCBI-ProteinID:  XP_022839756 OrcAE:  OT_ostta10g00840 LinkDB All DBs Position 10:complement(141358..141745) Genome browser AA seq 73 aa AA seqDB search MIEITLNDRLGKKIRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYTIYKDHITLEDY EVHDGANLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgagatcactctgaacgatcgattggggaagaaaattcgcgtcaagtgcaacgag gacgacacgatcggggacctgaagaaactcgtcgccgcgcagacggggacgcgcgcggag aagattcgcatacaaaagtggtacaccatctacaaggatcacatcacgctggaggattac gaggtgcacgacggggcaaatttagagctgtactacaactag

DBGET integrated database retrieval system