Ostreococcus tauri: OT_ostta12g01180 Help Entry OT_ostta12g01180  CDS       T01358                                  Name (RefSeq) SKP1 component, POZ domain   KO K03872   elongin-C Organism ota  Ostreococcus tauri Pathway ota04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ota00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     OT_ostta12g01180  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ota04121]     OT_ostta12g01180    03400 DNA repair and recombination proteins [BR:ota03400]     OT_ostta12g01180 Ubiquitin system [BR:ota04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      OT_ostta12g01180    Cul5 complex      OT_ostta12g01180 DNA repair and recombination proteins [BR:ota03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      OT_ostta12g01180 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ BTB DUF7447 Motif Other DBs NCBI-GeneID:  9836130 NCBI-ProteinID:  XP_003082270 OrcAE:  OT_ostta12g01180 UniProt:  Q00Y35 LinkDB All DBs Position 12:<190096..>190419 Genome browser AA seq 107 aa AA seqDB search MSAPALDPSTPITLVSREGVEFTVTLGALRVSGVLSRLFASADARDFEEQRTRTVRLRDV STAIVRKIVEYCEYRQTYEGSNKAPPPFEIAGEDAIELLMTANFLDV NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtccgctccagccctcgacccctcgacgccgataaccctcgtctcgcgcgagggcgtg gagttcaccgtcaccctcggcgcccttcgcgtctcgggcgtgctctctcggctcttcgcg agcgccgacgcgagagatttcgaggaacagcgaactcggacggttcgacttcgcgacgtc tccaccgcgatcgtgcgaaagatcgtcgagtactgcgagtacagacagacttacgaggga tcaaacaaggcgccgccgccgtttgagatcgccggcgaagacgcgatcgagctgttgatg acggctaactttttggacgtgtag

DBGET integrated database retrieval system