KEGG   Ottowia testudinis: J1M35_00820
Entry
J1M35_00820       CDS       T08188                                 
Name
(GenBank) FliI/YscN family ATPase
  KO
K03224  ATP synthase in type III secretion protein N [EC:7.4.2.8]
Organism
otd  Ottowia testudinis
Pathway
otd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:otd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    J1M35_00820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:otd02044]
    J1M35_00820
Enzymes [BR:otd01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     J1M35_00820
Secretion system [BR:otd02044]
 Type III secretion system
  Type III secretion core apparatus
   J1M35_00820
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ATP-synt_ab_N ABC_tran AAA_22 DUF87
Other DBs
NCBI-ProteinID: QTD45505
UniProt: A0A975CFZ5
LinkDB
Position
173632..174960
AA seq 442 aa
MTTGARPLLDPALLDTLQALQPVVARGRVVQAFGTTLRVSGLRAHIGQQCVIRDPARPQA
APLRAEVVGLRDHEAILVPLGHLQGVSMGAEVEIVERGALIPVGPALLGRVLDAFGEPLD
GRPLPAATPLRPFQTEPPNPLTRRPVDRPFITGVRAIDGLLTVGEGQRLGVFAMAGGGKS
TLLGMLARQAESDVNVIALVGERGREVREFLEDSLGPEGMARSVVVVSTSDRPAMERLRA
AQTATAIAEHFRAEGRRVLLMMDSVTRYARALREIGLSVGEPAVRRGFPPSVFAELPRLF
ERAGNDAHGSITAFYTVLAEDEDGSDPVAEEARSILDGHIVLSRKLGQAGHYPAIDVLAS
ASRVFNRVTTREHQDAALRTRALMAKHEEIRFLLQVGEYAAGSDALADAAIEAQPAIEAL
LRQRPDEASGMGQTQALLQALT
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaccaccggcgcccgccccctgctcgaccccgcgctgctcgacaccctgcaggcgctg
cagcccgtcgttgcgcgcggccgcgtggttcaggccttcggcaccacgctgcgcgtcagc
ggcctgcgcgcgcacatcggccagcagtgcgtgatccgcgacccggcccgcccgcaagcc
gcgccgctgcgcgccgaggtggtcggcctacgcgaccacgaagccatcctggtgccgctg
ggccacctgcaaggcgtgtcgatgggcgccgaggtcgaaatcgtcgagcgcggcgcgctg
atccccgtcggcccggcgctgctcggccgcgtgctcgatgcctttggcgagccgctcgac
ggccggccgctgcccgcggccacgccgctgcggccgtttcagaccgagccgcccaacccg
ctcacgcggcgcccggtcgaccgccccttcatcactggcgtgcgcgccatcgacggcctg
ctgacggtgggcgaaggccagcgcctgggcgtgttcgccatggccggcggcggcaaatcg
acgctgctgggcatgctggcgcgccaggccgagagcgacgtcaacgtcatcgccctggtc
ggcgagcgcggccgcgaggtgcgcgagtttctggaagacagcctgggccccgagggcatg
gcgcgctcggtggtcgtcgtctccaccagcgaccgcccggccatggagcgcctgcgcgcc
gcgcagaccgccaccgccatcgccgagcactttcgcgccgaagggcggcgcgtgctgttg
atgatggattcggtcacccgctacgcccgcgcgctgcgcgagatcggcctgtcggtcggc
gagccggcggtgcggcgcggctttccgcccagcgtgtttgcggagctgccgcgtctgttc
gagcgcgccggcaacgacgcgcacggcagcatcaccgccttctacaccgtgctggccgag
gacgaagacggctccgacccggtcgccgaagaagcgcgctccatcctcgacggccacatc
gtgctctcgcgcaagctgggccaggccggccactacccggccatcgacgtgctggccagc
gccagccgggttttcaaccgcgtcaccacgcgcgagcaccaggacgccgccctgcgcaca
cgcgcgctcatggccaagcacgaagagatccgctttctgctgcaagtgggcgaatacgcc
gctggcagcgacgcgctggccgacgccgccatcgaagcgcagccggccatcgaggcgctg
ctgcgccagcgccccgacgaagccagcggcatggggcagacccaggcgctgctgcaagca
ttgacatga

DBGET integrated database retrieval system