Ottowia testudinis: J1M35_11980 Help Entry J1M35_11980       CDS       T08188                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism otd  Ottowia testudinis Pathway otd01100   Metabolic pathways otd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:otd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J1M35_11980 (acpP)    00074 Mycolic acid biosynthesis     J1M35_11980 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J1M35_11980 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  QTD43863 UniProt:  A0A975H1I6 LinkDB All DBs Position complement(2559292..2559528) Genome browser AA seq 78 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQAAIDYANSKKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcatcgccgagcaactcggcgtggaggag tcgcaggtcaccaacgaaaaagccttcgtggccgacttgggtgccgactcgctcgacacg gtcgaactggtgatggcgctggaagatgagttcggcatcgagatccctgacgaggacgcc gaaaagatcaccacggtacaagccgccatcgactacgccaacagcaagaaggcgtag

DBGET integrated database retrieval system