Opitutus terrae: Oter_3287 Help Entry Oter_3287         CDS       T00689                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism ote  Opitutus terrae Pathway ote00998   Biosynthesis of various antibiotics ote01100   Metabolic pathways ote01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ote00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Oter_3287   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Oter_3287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF5715 Motif Other DBs NCBI-ProteinID:  ACB76566 UniProt:  B1ZTB2 LinkDB All DBs Position complement(4305235..4305498) Genome browser AA seq 87 aa AA seqDB search MTKDECKKVVLDIIADIAPDEDLSNVKPDVRLRDQLQLDSMDFLDIVMELRKRYGIEVPE KDYMQLASLDSSAEYLTPRFNALAEKS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaccaaagacgaatgcaagaaggtggtgctcgacatcattgccgacatcgcccccgac gaagatttgagcaacgtcaaacccgacgtacgcctgcgcgaccagcttcaactcgattcc atggacttcctcgacatcgtgatggagctccggaaacgctacggcatcgaagtgcccgag aaggattacatgcagctcgcgtcgctggacagttccgcggagtatttgacgccgcgattc aacgcgttggcggagaagagctga

DBGET integrated database retrieval system