KEGG   Opitutus terrae: Oter_3796
Entry
Oter_3796         CDS       T00689                                 
Name
(GenBank) spermidine/putrescine ABC transporter ATPase subunit
  KO
K11072  spermidine/putrescine transport system ATP-binding protein [EC:7.6.2.11]
Organism
ote  Opitutus terrae
Pathway
ote02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ote00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Oter_3796
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ote02000]
    Oter_3796
Enzymes [BR:ote01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.11  ABC-type polyamine transporter
     Oter_3796
Transporters [BR:ote02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter
    Oter_3796
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 AAA_16 SMC_N AAA_22 AAA_25 AAA Rad17 nSTAND1 AAA_28 Mg_chelatase RsgA_GTPase AAA_5 ORC-CDC6-like NACHT AAA_29 nSTAND3 ATPase_2 TsaE NB-ARC
Other DBs
NCBI-ProteinID: ACB77071
UniProt: B1ZYH3
LinkDB
Position
complement(4929546..4930628)
AA seq 360 aa
MNAMVELHGVTRRFGAVAAVDNVSLQIAAGEFLTLLGPSGCGKTTLLRLIAGFDTPTSGE
VWIEGTDVSRLPPYRRPVNQVFQSYALFPHLTVAENVGFGLKMQRVPKAEAAERVRQTLE
LVSLTGLDARRPHQLSGGQKQRVALARALVCRPKVLLLDEPLSALDAKLRLTMQLELKRL
QRQLGITFVFVTHDQEEALTMSDRIAVVNRGRIEQLDTAPEIYHRPATPFVADFVGQGNL
LAAERVAMAGFDVRVRLAGGLEVLVPANNWPMELSRALISIRPEKVHVSRLPIAASNSFA
VEVKEEVFRGATDHLVLVTDIGTRLNAVVANESELGDIFHAGDSVFCALHPDDLVVVRAE
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaatgcgatggtcgagttgcacggagtcacccgccgtttcggcgccgtcgcggcggtg
gacaacgtcagcctgcagatcgccgcgggcgagtttctcacgctgctgggcccctcgggt
tgtggcaaaaccaccctgctgcgactgatcgcaggattcgacacgccgacgagcggggag
gtgtggatcgagggcacggacgtttcgcggctgccgccgtatcggcgaccggtgaaccag
gtttttcagagctatgcgctcttcccgcatctgacggtcgcggagaatgtgggcttcggc
ctaaaaatgcagcgggtgccgaaagcggaggccgccgagcgcgtacggcagacgctcgaa
ctcgtgtcgctgaccgggctcgacgcgcggcggccgcaccagctttcgggtggacagaag
cagcgcgtggcgctcgcgcgtgcgctcgtctgccggccgaaagtgctcttgctcgacgag
ccgctgtcggcgctcgatgcgaagctgcggctgacgatgcaactcgagctgaagcggctg
caacggcagctcgggatcacgttcgtgtttgtcacgcacgaccaggaggaggcattgacg
atgagcgatcggatcgcggtcgtgaaccgcggcagaatcgagcagctcgacacggcaccg
gagatttatcaccggccggcgacgcccttcgtcgcggatttcgtcggccagggcaacctg
ctcgcggcggagcgcgtggccatggcggggttcgatgtgcgcgtgcgactggcgggcggg
cttgaggtgctggtgcccgcgaacaactggccgatggagctttcgcgggcgctgatctcg
atccggcccgagaaggttcacgtgtctcggctgcccatcgcggcatcgaattcgttcgcc
gtcgaggtgaaggaagaggtgttccgcggcgcgaccgatcacctggtgctggtgaccgac
attggcacgcggctcaacgccgtcgtggcgaacgagagcgagctgggcgacatctttcac
gcgggcgacagcgtgttctgcgcgctgcatccggacgacctggtcgtcgtccgagcggag
tga

DBGET integrated database retrieval system