Ottowia oryzae: C6570_02750
Help
Entry
C6570_02750 CDS
T05363
Name
(GenBank) 2-aminoadipate aminotransferase
KO
K05825
2-aminoadipate transaminase [EC:2.6.1.-]
Organism
otk
Ottowia oryzae
Pathway
otk00300
Lysine biosynthesis
otk00630
Glyoxylate and dicarboxylate metabolism
otk01100
Metabolic pathways
otk01110
Biosynthesis of secondary metabolites
otk01210
2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:
otk00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
C6570_02750
09105 Amino acid metabolism
00300 Lysine biosynthesis
C6570_02750
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
GGACT
Asp_aminotransf
Motif
Other DBs
NCBI-ProteinID:
AVO33294
UniProt:
A0A2S0MBM1
LinkDB
All DBs
Position
complement(588101..589729)
Genome browser
AA seq
542 aa
AA seq
DB search
MYATKGDLVNLLFSYGTLQQDDVQRSTFGRLLLGRADALVGYAQTWLKIEDAQVVATSGK
THHPIVRRTGHANDRVSGTVFEISDAELAHADAYEVADYRRVRADLASGQQAWVYIDARS
HNPLLDPRQESTTMNPNDLNSTSPWNLAERAHGMNPSAIREILKVTERPGILNFAGGLPS
PETFPVDAMRAACDAVLGGPAARPSLQYASSEGLPELRQWVANEMAKQGAQVSPDQVLIT
TGSQQGLDLIAKVLLDKDSPLLVESPTYLGALQAFMPMQPKVVSIASDSGGLSLPVLREQ
LSKAEQSGQRPRFIYLLPNFQNPTGRTMDEQRRNDVIAVCREFGLPIVEDNPYGELWFDA
PPPAPLLSRWPEGVLYLGSFSKILAPGLRLGYVIAPPALYPKLLQAKQAADLHTPGFNQR
VVAEVIKDGFLDTHVPTIRARYHAQRDAMLAALARELGPTGAEWTQPVGGMFVWVRLPEG
VNAQALLPKAVDAGMAFVPGAPFYADHADPRTLRLSFVTSTPEQIDRGIAALAQVIRQAT
GG
NT seq
1629 nt
NT seq
+upstream
nt +downstream
nt
atgtacgcaacgaaaggtgatcttgtgaacctgcttttctcctacggcacactgcagcaa
gacgacgtgcagcgcagcaccttcggccgcctgctgctcggcagggcagatgccctggtg
ggttacgcccagacctggttgaaaattgaagacgcccaggtggtggccaccagcggcaag
actcaccaccccatcgtgcgccgcaccggccacgcaaacgaccgcgtcagcggcacggtg
ttcgagatttccgacgccgagctggcgcacgccgacgcctatgaggtggccgactatcgg
cgcgtgcgggccgacctcgcatccggccagcaggcctgggtgtacatcgatgcccgcagc
cacaaccccttacttgatccccgccaagaaagcacaaccatgaatcccaacgatctgaac
agcacgtccccctggaatttggccgagcgcgcccacggcatgaacccatcggccattcgc
gaaatcctgaaagtgacggaacgcccgggcatcctcaacttcgccggcggcctgccctcg
cccgagacctttccggtggacgccatgcgcgccgcctgcgacgcggtgctaggcggcccg
gcggcgcgcccgtcgctgcagtacgcgtccagcgaaggcctgcccgagctgcgccagtgg
gtcgccaacgagatggccaagcagggcgcgcaggtgtcgcccgaccaggtgctgatcacc
accggcagccagcaggggctggatctgatcgccaaggtgctgctggacaaggacagcccg
ctgctggtggagtcgcccacctacctgggcgcgctgcaggcgttcatgccgatgcagccc
aaggtcgtcagcattgccagcgattctggcggcttgtctttgccagtcctgcgcgaacag
ctatcgaaagcagagcaatctggccaacgccctcgcttcatctacctgctgcccaacttc
cagaaccccaccggccgcaccatggatgagcagcgccgcaacgacgtgatcgccgtctgc
cgcgaattcggattgcccatcgttgaagacaacccgtatggcgagctgtggttcgacgcg
ccgccgcctgcgccgctgctgtcgcgctggcccgaaggcgtgctgtacctgggttcgttc
agcaaaatcctggcgccgggcctgcgcctgggctacgtcatcgccccgccggcgctgtac
cccaagctgctgcaggccaagcaggcggccgacctgcacacgcccggcttcaaccagcgc
gtggtggccgaggtcatcaaggacggcttcctggacacgcacgtgcccaccatccgcgcc
cgctaccacgcccaacgcgacgccatgctggccgcgctggcgcgcgaacttggccccacc
ggcgccgaatggacgcagcccgtgggcggcatgttcgtgtgggtgcgcctgccggaaggc
gtgaacgcgcaagccctgctgcccaaggctgtggacgcgggcatggccttcgtgcccggc
gcgccgttctacgccgaccacgccgatccgcgcaccctgcgcctgtccttcgtcacctcc
acgcccgagcagatcgaccgcggcatcgcggcgctggcgcaggtgatccggcaggccacc
ggcggctga
DBGET
integrated database retrieval system