KEGG   Ottowia oryzae: C6570_08245
Entry
C6570_08245       CDS       T05363                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
otk  Ottowia oryzae
Pathway
otk00770  Pantothenate and CoA biosynthesis
otk01100  Metabolic pathways
otk01240  Biosynthesis of cofactors
Module
otk_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:otk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C6570_08245
Enzymes [BR:otk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     C6570_08245
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig PIN
Other DBs
NCBI-ProteinID: AVO34225
UniProt: A0A2S0MEA7
LinkDB
Position
1776748..1777248
AA seq 166 aa
MSRHVIAVYPGTFDPITLGHEDIVRRARELFDEVIIAVAIAHHKKTLFTLDERLAMVTES
AKQWPGVRVEPFDGLVSHFVRDKGGRAMVRGLRAVTDFDYEFQLAGMNSKLAPEVESVFL
TPSGQYQFVSSTFVREIALLGGDVKQFVSPHVWQRLMARKDAGTKP
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagccgccacgtgatcgccgtctatcccggcacgttcgaccccatcacccttgggcac
gaagacatcgtgcgccgtgcgcgcgagctgttcgacgaggtcatcatcgcggtggccatc
gcgcaccacaagaagacgctgttcacgctggatgagcggctggcgatggtcaccgaatcg
gccaaacagtggccgggcgtgcgcgtggagccgttcgacgggctggtcagccatttcgtg
cgcgacaagggcggccgcgccatggtgcgcgggctgcgcgcggtgaccgatttcgactac
gaatttcaactggcgggcatgaacagcaagctggcgccggaggtggaatcggtcttcctc
acccccagcgggcagtaccagtttgtcagcagcaccttcgtgcgtgaaatcgcgctgctg
ggcggcgacgtgaagcagttcgtgtcgccccacgtgtggcagcggctgatggcgcgcaag
gacgcgggcaccaagccctga

DBGET integrated database retrieval system