Ottowia oryzae: C6570_12130 Help Entry C6570_12130       CDS       T05363                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism otk  Ottowia oryzae Pathway otk01100   Metabolic pathways otk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:otk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C6570_12130    00074 Mycolic acid biosynthesis     C6570_12130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C6570_12130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVO34899 UniProt:  A0A2S0MG74 LinkDB All DBs Position 2666422..2666706 Genome browser AA seq 94 aa AA seqDB search MNSTAPAPSEDLLIREVAQLLVTSLNLDMAPEDIAPDTPLYGDGLGLDSIDILEVALAVS KKYGFQLRADDENNEAIYSSLRNLARHIAAHRKT NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaacagcactgcgcccgcgccctctgaagacctcctcatccgcgaagttgcccaactt ttggtcacatccctgaacctggacatggcgcccgaagacattgctcccgacacgccgctg tacggcgacgggctgggtctggattccatcgatattcttgaagtggcactggcagtctcc aagaagtacgggtttcaactccgtgctgacgacgagaacaacgaggccatctattcttca ctgcgcaatctggcgcgccatatcgctgcgcaccggaaaacctga

DBGET integrated database retrieval system