KEGG   Ottowia oryzae: C6570_16395
Entry
C6570_16395       CDS       T05363                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
otk  Ottowia oryzae
Pathway
otk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:otk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C6570_16395 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:otk02022]
    C6570_16395 (phoB)
Two-component system [BR:otk02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   C6570_16395 (phoB)
SSDB
Motif
Pfam: Trans_reg_C Response_reg HTH_11 GerE
Other DBs
NCBI-ProteinID: AVO35623
UniProt: A0A2S0MIV4
LinkDB
Position
complement(3585398..3586120)
AA seq 240 aa
MRTMPRVLIVEDEPPIAELIAVNLRHNGFQPTWAMDSETAQRELDDQLPDVILLDWMLPG
ESGLALAKKWRKDPRTKAVPILMLTARGDESDRVAGLDAGADDYITKPFSTKEMLARIRA
VLRRRSPEMAGGVVAIGALVLDASTHRVTYDGQPLKMGPTEFKLLHYFMQNSERVHSRGQ
LLDKVWGDHVFIEERTVDVHVKRLREALGAAGVLIETVRGAGYRLTAQPLAHATPATASS
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagaacgatgccgagggtgctgatcgtcgaggatgagccgcccatcgcagagctgatc
gccgtcaacctgcgccacaacggctttcagcccacgtgggccatggacagcgaaaccgcc
cagcgcgagttggacgatcagttgccggacgtcatcttgctggactggatgctgcccggc
gaaagcgggctggcgctggccaagaaatggcgcaaagatccgcgcacgaaggccgtgccc
atcctgatgctgaccgcgcgcggcgacgaatccgaccgcgtcgcggggctggacgccggg
gccgacgactacatcaccaagccgttttccaccaaggaaatgctggcccgcatccgtgcg
gtgttgcgccgccgctcgcctgaaatggccggcggggtggtggccatcggcgcgctggtg
ctggacgcgtcgacgcaccgcgtgacctatgacggccagccgctgaagatggggccgacc
gaattcaagctgctgcactacttcatgcagaactctgagcgggtgcacagccgcggccag
ttgctcgacaaagtttggggcgaccacgtcttcatcgaagagcgcacggtggacgtgcac
gtcaaacgcctgcgtgaggcgctgggcgcggccggcgtgctgatcgaaaccgtgcgtggt
gcgggctaccgcctgacggcgcaaccgttggcccacgcgacgcccgcgaccgcgtcttcc
tga

DBGET integrated database retrieval system