Ottowia oryzae: C6570_17245 Help Entry C6570_17245       CDS       T05363                                  Name (GenBank) histone   KO K03746   DNA-binding protein H-NS Organism otk  Ottowia oryzae Brite KEGG Orthology (KO) [BR:otk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:otk03036]     C6570_17245    03400 DNA repair and recombination proteins [BR:otk03400]     C6570_17245 Chromosome and associated proteins [BR:otk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     C6570_17245 DNA repair and recombination proteins [BR:otk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       C6570_17245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AVO35769 UniProt:  A0A2S0MIR2 LinkDB All DBs Position 3774919..3775209 Genome browser AA seq 96 aa AA seqDB search MATYKELLQQQEALAQQIEEARKKEIADAVAQVRALVNDFGLTQQDVFPGGRKSAKSTSG TKVAPKYRDPATGQTWTGRGKAPKWIEGRDRAQFVI NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggccacttacaaggaactgctgcagcagcaagaagcgcttgcccagcaaatcgaagaa gcccgcaagaaggaaatcgccgacgctgtggcgcaggtgcgcgcgttggtgaacgatttt gggttgacgcaacaagacgttttccccggtggccgtaaatccgccaaatcgacttctggc accaaagtggctcctaaataccgcgacccggccactggccaaacctggaccggccgcggc aaagcacccaagtggattgaaggccgcgaccgcgcccaattcgttatctga

DBGET integrated database retrieval system