Octadecabacter temperatus: OSB_03210
Help
Entry
OSB_03210 CDS
T04001
Symbol
yidC
Name
(GenBank) Membrane protein insertase YidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
otm
Octadecabacter temperatus
Pathway
otm02024
Quorum sensing
otm03060
Protein export
otm03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
otm00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
OSB_03210 (yidC)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
OSB_03210 (yidC)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
OSB_03210 (yidC)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
otm03029
]
OSB_03210 (yidC)
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
otm02044
]
OSB_03210 (yidC)
Mitochondrial biogenesis [BR:
otm03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
OSB_03210 (yidC)
Secretion system [BR:
otm02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
OSB_03210 (yidC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YidC_periplas
60KD_IMP
DPM3
Motif
Other DBs
NCBI-ProteinID:
AKS44889
UniProt:
A0A0K0Y1S8
LinkDB
All DBs
Position
complement(284592..286370)
Genome browser
AA seq
592 aa
AA seq
DB search
MDDQNKNLILATALSFLVILVWFVLFPPPEPEEPAPTAEITATDGGTLSVDADVPAQVGE
TAILAPAAPEEVIANAPRVTIDSASLIGSLSLTGGRIDDLSLKSYHETLADEELVRLLAP
IGTDHPYYASHGWVAAVGATADQVPSASTEWQIESGDTLSEGNDVTLVWDNGAGLIFRKT
FSVDEHFLFTVEQSVENTTGNEVALRPYGLVARHGEPEQIGFFIQHEGVVRMSDGSMEEI
NYDDMPDLTTDEGRIEVEENGWIGFSDQYWMTALIPTPGRDFRSTAKFGNDIYQVETVYP
MVTVAAGASASANTQFFAGAQEWEVIRGYQNDLGIDRFLDSIDWGWFFFLTKPIFAVLHW
LNGLIGNMGWAIIGLTLIIKALLLPLAYKSYVSMAKMRELQPQMAKMKEDAGDDREKLQK
GMMALYKENKVNPASGCLPILMQIPIFFSLYKVIFVTIELRHAPWLGWVNDLSAPDSSSL
FNLFGLFPWDAPGPESFLSLVFIGIMPIVLGISMWLQQKLNPAPTDATQKMIFAWMPWVF
MFMLGSFASGLVLYWIANNTITFIQQYAIMRSQGFKPDVFGNILGRNKADTE
NT seq
1779 nt
NT seq
+upstream
nt +downstream
nt
atggacgaccagaacaagaacctaatcctcgcaacagcactcagcttcctcgtgattctg
gtatggttcgtgttgtttccaccaccagagccagaagagcccgcaccaacagctgaaatc
acagcgacggatggtggaacgctcagcgttgatgcagacgttccagcgcaagtgggtgaa
acggccatcttggcgcctgctgcaccagaagaagtcatcgcgaacgccccgcgtgtcacc
atcgacagcgcgagcctgattggttccctgtccctgactggtggccgcattgatgacctc
tccttgaagtcctatcacgaaactctcgcggacgaagaacttgtacgcctcctcgcgccg
atcggcactgaccacccatattatgcgtcccatggttgggtcgcagcggttggggcaacg
gctgatcaggttccatctgcgtccacggaatggcagatcgaaagcggtgatacgctttcc
gaaggcaacgacgtaaccctcgtttgggacaacggcgctggattgatcttccgcaagaca
ttctctgtcgatgaacactttttgttcactgtcgagcaatccgttgaaaacacgacaggc
aacgaagtcgcgctgcgcccttacgggttggttgcgcgccacggcgagccagagcaaatc
ggcttcttcattcagcacgaaggtgttgtgcggatgtctgatgggtcgatggaagaaatc
aactatgatgacatgcccgacctcacgactgacgaaggccggatcgaagttgaagaaaac
ggttggatcggtttttcagaccagtactggatgacggcactgatcccgacaccaggtcgg
gatttccgatcaacggcgaaattcggcaatgacatctaccaagtcgaaactgtctatccg
atggttacggttgcggctggtgcatctgccagtgcgaacacgcagttctttgcgggtgcg
caggaatgggaagtcattcgcggataccaaaatgaccttggcattgatcgtttcctcgac
agcatcgactggggttggttcttcttcctcacgaaaccaattttcgcagttcttcactgg
ctcaacgggctgataggcaacatgggttgggccatcatcggccttacgctgatcatcaag
gcactgctgcttcctcttgcatataaatcctacgtctcaatggcgaagatgcgtgagttg
cagccgcaaatggctaagatgaaggaggacgcgggcgatgaccgtgaaaaactccagaag
ggcatgatggcactttataaggagaacaaggtgaaccctgcatccggctgtttgccgatc
ttgatgcagatcccgatcttcttctcgctctacaaggttatctttgtaacaatcgaattg
cgccacgcaccttggctcggttgggtcaacgacctgagcgcgcctgactcctcatctttg
ttcaacctgtttggcctgttcccatgggatgcaccgggtccagagtccttcttgtcgttg
gttttcatcgggatcatgccaatcgttcttggtatttccatgtggctgcagcagaagctg
aacccggcccccacagacgcgacgcagaagatgatctttgcgtggatgccttgggtcttc
atgttcatgctcggtagctttgccagtggccttgttctgtactggatcgcgaacaacacg
atcacgttcatccagcagtacgcgatcatgcgcagtcagggtttcaaacctgatgttttc
ggcaacattctcgggcgtaacaaagcggacactgagtaa
DBGET
integrated database retrieval system