KEGG   Ottowia sp. oral taxon 894: ADJ79_09235
Entry
ADJ79_09235       CDS       T04031                                 
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
oto00770  Pantothenate and CoA biosynthesis
oto01100  Metabolic pathways
oto01240  Biosynthesis of cofactors
Module
oto_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:oto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ADJ79_09235
Enzymes [BR:oto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     ADJ79_09235
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AKU67356
LinkDB
Position
2103480..2103980
AA seq 166 aa
MSRPVIAVYPGTFDPITLGHEDIARRARELFDEVIVAVAIAHHKKTLFTLEERLEMAQTS
ARQWPGVRAEPFEGLISHFVQAKGGKAMVRGLRAVTDFDYEFQLAGMNGVLAPEVETVFL
TPGTRYQFVSSTFVREIALLGGDAEQFVAPHVWQRLLEKRRSSAKP
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagccgccctgtcatcgccgtctatcccggcacgttcgatcccatcacgctgggccat
gaagacatcgcacgccgcgcgcgcgagctgtttgacgaagtcatcgtcgccgtggccatc
gcccatcacaaaaaaaccctgttcaccttggaagagcggctggagatggcgcagacgtcg
gcccggcaatggccgggcgtgcgggcggagccgttcgaggggctgatcagccacttcgtg
caagccaaaggcggcaaggcaatggtgcgcggactgcgcgcggtcaccgactttgactac
gagttccagcttgcgggcatgaacggcgtgctggcgccggaggtggagacggtgtttctc
acgcccggcacgcgctaccagttcgtcagcagcaccttcgtgcgcgaaatcgccctgctg
ggcggcgatgccgagcagttcgtggccccgcacgtgtggcagcggctactggaaaaacgg
cgaagcagcgccaagccctga

DBGET integrated database retrieval system