Ottowia sp. oral taxon 894: ADJ79_09680 Help Entry ADJ79_09680       CDS       T04031                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism oto  Ottowia sp. oral taxon 894 Pathway oto01100   Metabolic pathways oto01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:oto00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ADJ79_09680    00074 Mycolic acid biosynthesis     ADJ79_09680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ADJ79_09680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKU67418 LinkDB All DBs Position 2203248..2203532 Genome browser AA seq 94 aa AA seqDB search MNAPVSPADENALLAELAQMLVDCLNLDMKPAEIDPDAPLYGDGLGLDSIDILEVALAVS KKYGFQLRAEDENKQAIYSSLRSLARHIAAHRTI NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaacgctcccgtttcccccgctgatgaaaacgccttgctggctgaattggcccagatg ctggtggactgcctcaatctggatatgaagcctgcagaaatcgacccggatgcgcccttg tatggcgatggactggggctggactcgatcgacattctggaagtggcgctggcggtgtcc aagaaatacggctttcagctgcgggctgaagacgagaacaagcaagccatctacagcagc ctgcgcagcctggcccggcacatcgcggcgcaccgcacgatttga

DBGET integrated database retrieval system