Oryzomicrobium terrae: OTERR_04980 Help Entry OTERR_04980       CDS       T06190                                  Symbol grxC Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism otr  Oryzomicrobium terrae Brite KEGG Orthology (KO) [BR:otr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:otr03110]     OTERR_04980 (grxC) Chaperones and folding catalysts [BR:otr03110]  Protein folding catalysts   Protein disulfide isomerase    OTERR_04980 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_2 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  QEL63974 UniProt:  A0A5C1E5J5 LinkDB All DBs Position 549539..549805 Genome browser AA seq 88 aa AA seqDB search MAKPRVLMYSTAVCPYCVRAEQLLTQKGVVDIEKVRVDLEPARREEMMQKTGRRTVPQIY IGDFHVGGCDDLYALERDGRLDPLLAGA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggctaaaccccgtgtgctgatgtactccaccgccgtttgtccctactgcgtgcgtgcc gagcagctgctcacgcaaaagggcgtggttgatattgaaaaggtgcgcgtcgatctcgaa ccggcccggcgcgaggaaatgatgcagaaaaccggccggcgcaccgtgccgcagatttac attggcgactttcacgtcggcggttgcgacgacctctatgcccttgagcgggatggacgt ctcgacccgctgctggcgggtgcctga

DBGET integrated database retrieval system