Oryzomicrobium terrae: OTERR_06260 Help Entry OTERR_06260       CDS       T06190                                  Symbol groES Name (GenBank) chaperonin GroES   KO K04078   chaperonin GroES Organism otr  Oryzomicrobium terrae Brite KEGG Orthology (KO) [BR:otr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:otr03110]     OTERR_06260 (groES)    03029 Mitochondrial biogenesis [BR:otr03029]     OTERR_06260 (groES) Chaperones and folding catalysts [BR:otr03110]  Heat shock proteins   HSP10    OTERR_06260 (groES) Mitochondrial biogenesis [BR:otr03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     OTERR_06260 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 ExoX-like_C Motif Other DBs NCBI-ProteinID:  QEL64102 UniProt:  A0A5C1E5A9 LinkDB All DBs Position 690683..690973 Genome browser AA seq 96 aa AA seqDB search MKIRPLHDRVIVKRVEAERTTASGIVIPDSAGEKPDQGEILAVGNGKVLEDGKVRALEVK VGDRVLFGKYAGQTVKVDGQELLVMREEDIMGVVEA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaaatccgtcccttgcacgaccgtgtgatcgtcaagcgcgtcgaagccgaacgcacc accgcctccggtatcgttattcccgattccgccggtgagaagccggaccagggtgaaatc cttgccgtcggtaacggcaaggtcctcgaagacggcaaggtccgtgccctcgaagtgaag gtgggcgaccgcgtcctgttcggcaagtacgccggccagaccgtcaaggtggatggccag gaactgctggtcatgcgcgaagaagacatcatgggcgtggtggaagcctaa

DBGET integrated database retrieval system