Oryzomicrobium terrae: OTERR_11900 Help Entry OTERR_11900       CDS       T06190                                  Symbol hupB Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism otr  Oryzomicrobium terrae Brite KEGG Orthology (KO) [BR:otr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:otr03032]     OTERR_11900 (hupB)    03036 Chromosome and associated proteins [BR:otr03036]     OTERR_11900 (hupB)    03400 DNA repair and recombination proteins [BR:otr03400]     OTERR_11900 (hupB) DNA replication proteins [BR:otr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     OTERR_11900 (hupB) Chromosome and associated proteins [BR:otr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     OTERR_11900 (hupB) DNA repair and recombination proteins [BR:otr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       OTERR_11900 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QEL64666 UniProt:  A0A5C1E6V5 LinkDB All DBs Position 1318139..1318411 Genome browser AA seq 90 aa AA seqDB search MNKSELIEQIAKSAEISKAAAGRALDATVASIKTSLKKGGMVTLVGFGTFYVGKRAARSG RNPRTGAAIKIKAAKVPKFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaatccgaactgatcgaacaaatcgccaagtcagccgagatttccaaagctgcc gctggtcgtgcgctggatgccacagtggcatccatcaaaaccagcctcaaaaaaggggga atggtgacgctggtggggtttggcactttctacgtaggcaagcgggcggcgcgaagtggc agaaatccgcgtaccggcgccgcaatcaagatcaaggcggcaaaagtccctaagttccgc gctggcaaagccctgaaggatgcggtaaactaa

DBGET integrated database retrieval system