Oligella ureolytica: I6G29_00175 Help Entry I6G29_00175       CDS       T07321                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism oue  Oligella ureolytica Brite KEGG Orthology (KO) [BR:oue00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oue03036]     I6G29_00175    03400 DNA repair and recombination proteins [BR:oue03400]     I6G29_00175 Chromosome and associated proteins [BR:oue03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     I6G29_00175 DNA repair and recombination proteins [BR:oue03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       I6G29_00175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS UTP20 Histone_HNS_N CusS DUF1002 Motif Other DBs NCBI-ProteinID:  QPT38934 UniProt:  A0A379B186 LinkDB All DBs Position unnamed:complement(27498..27785) Genome browser AA seq 95 aa AA seqDB search MTDLKNMNADELRSLRAKIDSELKKREAKERQEARKKIIDIAKTHGINIAELAKNERLYR NPDNQWETWTGRGRKPKWVKEWLEAGRSLEELEVS NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgactgacctcaagaacatgaacgccgacgagctgcgttcacttcgtgcgaaaattgat tcagaactcaaaaaacgagaggctaaggaaaggcaggaagcacggaaaaaaattatcgac attgccaagacgcacggcatcaacattgccgagttggctaaaaatgaacgtttataccgt aaccctgacaatcagtgggagacgtggactggacgtggccgcaagccaaagtgggttaag gaatggcttgaagccggacgttcactagaagaactggaagtatcatga

DBGET integrated database retrieval system