Oligella ureolytica: I6G29_10860 Help Entry I6G29_10860       CDS       T07321                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism oue  Oligella ureolytica Pathway oue01100   Metabolic pathways oue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:oue00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6G29_10860 (acpP)    00074 Mycolic acid biosynthesis     I6G29_10860 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6G29_10860 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QPT39626 UniProt:  A0A378XJ61 LinkDB All DBs Position 2222102..2222341 Genome browser AA seq 79 aa AA seqDB search MDSIEQRVKSIIAEQLAIKDEAEVKNESSFLDDLGADSLDMVELVMCLEDEFETEIPDEE AEKITTVQQAIDFITANKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggatagcatcgaacaacgcgtcaagagcattattgctgaacaattagcgattaaggat gaggcagaagtaaaaaacgaatcttctttcttagatgacttaggcgctgactcacttgac atggttgagttagttatgtgcttagaagacgagttcgaaaccgaaatccctgacgaagaa gcagaaaaaatcactactgttcaacaagctattgattttatcactgctaacaagaagtaa

DBGET integrated database retrieval system