Oscillibacter valericigenes: OBV_13480 Help Entry OBV_13480         CDS       T01636                                  Symbol porD Name (GenBank) pyruvate synthase subunit PorD   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism ova  Oscillibacter valericigenes Pathway ova00010   Glycolysis / Gluconeogenesis ova00020   Citrate cycle (TCA cycle) ova00620   Pyruvate metabolism ova00633   Nitrotoluene degradation ova00640   Propanoate metabolism ova00650   Butanoate metabolism ova00680   Methane metabolism ova00720   Other carbon fixation pathways ova01100   Metabolic pathways ova01110   Biosynthesis of secondary metabolites ova01120   Microbial metabolism in diverse environments ova01200   Carbon metabolism ova01210   2-Oxocarboxylic acid metabolism Module ova_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:ova00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     OBV_13480 (porD)    00020 Citrate cycle (TCA cycle)     OBV_13480 (porD)    00620 Pyruvate metabolism     OBV_13480 (porD)    00640 Propanoate metabolism     OBV_13480 (porD)    00650 Butanoate metabolism     OBV_13480 (porD)   09102 Energy metabolism    00720 Other carbon fixation pathways     OBV_13480 (porD)    00680 Methane metabolism     OBV_13480 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     OBV_13480 (porD) Enzymes [BR:ova01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase (ferredoxin)      OBV_13480 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_7 Fer4_9 Fer4_10 Fer4_16 Fer4_21 Fer4_17 Fer4_4 LdpA_Fe-S-bd Fer4_8 Fer4_3 Fer4_15 Motif Other DBs NCBI-ProteinID:  BAK98546 LinkDB All DBs Position 1289840..1290145 Genome browser AA seq 101 aa AA seqDB search MKWKASEMTPDVKWKDITPGCNIFEGGTSCTVETGDWRTMKPVLDADKCRQCLLCAPVCP DMSIPVKNGKRGDFNYFFCKGCGICANACPFGAITMVKDEK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagtggaaagcaagcgagatgacgccggacgttaaatggaaggatattactcccggc tgcaatattttcgagggcggcacgtcctgtaccgtggagaccggcgactggcggactatg aagccggtgctggacgcggacaagtgcaggcagtgcctgctgtgcgcgcccgtgtgtccg gatatgtccattcccgtgaagaacggcaagcggggcgatttcaattacttcttctgcaaa ggctgcggaatctgcgccaacgcgtgtcccttcggggccatcacgatggtcaaggacgag aaataa

DBGET integrated database retrieval system