Oxalobacter vibrioformis: NB640_03230 Help Entry NB640_03230       CDS       T08675                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism ovb  Oxalobacter vibrioformis Brite KEGG Orthology (KO) [BR:ovb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ovb03036]     NB640_03230    03400 DNA repair and recombination proteins [BR:ovb03400]     NB640_03230 Chromosome and associated proteins [BR:ovb03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     NB640_03230 DNA repair and recombination proteins [BR:ovb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       NB640_03230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS GlutR_dimer Histone_HNS_N GCS2 Motif Other DBs NCBI-ProteinID:  WAW10687 UniProt:  A0A9E9M030 LinkDB All DBs Position 646161..646451 Genome browser AA seq 96 aa AA seqDB search MSTYKQIQDQIKQLQQQAEELRKKELGNAISQVKSIMAEFGITFADLGMGSKKKSTRTRA PLAPKYRNPSTGETWSGRGKAPKWIDQKNKEKYLIK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcgacatacaaacagatacaggatcaaatcaaacaactccagcaacaggcggaagaa ttgagaaagaaagaactgggcaatgccatcagccaggttaaatccattatggcggaattt ggtattacctttgctgatctcggcatgggttcaaaaaagaaaagcacccgtacaagggcg ccgcttgccccaaaataccgtaatccgtctacgggagaaacatggtcagggcgcgggaaa gcacccaaatggatcgatcagaaaaacaaagaaaaatacctgattaaataa

DBGET integrated database retrieval system