Oxalobacter vibrioformis: NB640_08365 Help Entry NB640_08365       CDS       T08675                                  Name (GenBank) S24 family peptidase   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism ovb  Oxalobacter vibrioformis Brite KEGG Orthology (KO) [BR:ovb00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ovb01002]     NB640_08365   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ovb03400]     NB640_08365 Peptidases and inhibitors [BR:ovb01002]  Serine peptidases   Family S24: LexA family    NB640_08365 DNA repair and recombination proteins [BR:ovb03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     NB640_08365 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_S24 Motif Other DBs NCBI-ProteinID:  WAW11330 UniProt:  A0A9E9LX27 LinkDB All DBs Position complement(1678959..1679246) Genome browser AA seq 95 aa AA seqDB search MNRNSSFLFRVAGDSMEGVGIFDGDVIVVDKSIEPRHNMIVVAVIDGGFTVKRLFKKEKI VRLIPENPKYDPIDFHEGQEMQVWGVVTSCIRKLF NT seq 288 nt NT seq  +upstreamnt  +downstreamnt ataaatcgcaattcatcttttctcttccgcgttgccggcgacagcatggaaggcgtagga atatttgatggtgatgtgattgtggtcgacaagtccatcgaacccaggcataacatgatc gtggttgccgtcattgatggcggcttcactgtgaagcgattattcaaaaaggaaaaaatc gtgcgccttatccctgaaaacccgaaatatgatccgattgattttcacgaagggcaagaa atgcaggtttggggggttgttacgtcctgtatcagaaaattattctga

DBGET integrated database retrieval system